Recombinant Shewanella oneidensis Putative protein-disulfide oxidoreductase (SO_3870)

What is Shewanella oneidensis and why is it significant for research?

Shewanella oneidensis MR-1 is a gram-negative facultative anaerobic bacterium first isolated from Lake Oneida, NY in 1988 . It has garnered significant research interest due to its versatile respiratory capabilities, particularly its ability to reduce various metal ions and survive in environments with or without oxygen . S. oneidensis possesses a unique cell envelope consisting of three layers: outer membrane, periplasmic space (peptidoglycan), and inner membrane (plasma membrane) . Its remarkable ability to reduce toxic compounds like uranium, chromium, and mercury makes it exceptionally valuable for bioremediation applications . The bacterium can utilize numerous terminal electron acceptors during anaerobic respiration, including both soluble and insoluble organic and inorganic compounds . This metabolic versatility has made S. oneidensis a model organism for studying bacterial adaptation to diverse environmental conditions and electron transport mechanisms.

What is protein-disulfide oxidoreductase (SO_3870) and what is its primary function?

The protein-disulfide oxidoreductase (SO_3870) from Shewanella oneidensis, also referred to as DsbI, is a putative redox enzyme involved in disulfide bond formation and regulation . Based on sequence analysis, SO_3870 belongs to the thioredoxin protein family and likely catalyzes dithiol-disulfide exchange reactions using a CXXC sequence motif at its active site . The primary functions of SO_3870 appear to include:

• Formation of disulfide bonds in target proteins (oxidase activity)

• Reduction of disulfide bonds (reductase activity)

• Rearrangement of incorrectly formed disulfide bonds (isomerase activity)

The protein contains 212 amino acids with the sequence: MSINEVFRSFKAQPVNQLAKIQAERPIWFVMVGAAIFLILSAIFYFQLFLAMAPCEKCVYIRFSQSCIVIAGLIILINPRNNILKTLGLLLAWYAMIQGWIWSFELMKIHDAAHMVVDESMDFFAAAGDAAGSACSTEPRFPLGLPLDKWLPFEFAPTGGCGEDDWALFGLNMAHYCMIAYATFMVCLAPLTLGWFASFMTDRRNTIVYQTR . Its functional characterization suggests similarity to protein disulfide oxidoreductases found in other organisms, particularly those involved in maintaining proper protein folding in the cell envelope.

How does the CXXC motif contribute to the catalytic activity of SO_3870?

The CXXC (Cysteine-X-X-Cysteine) motif forms the catalytic core of protein-disulfide oxidoreductases, including SO_3870 . This conserved sequence plays a crucial role in the protein's redox activities through the following mechanisms:

• The two cysteine residues within the motif can cycle between oxidized (disulfide) and reduced (dithiol) states, enabling electron transfer reactions

• The amino acids positioned between the cysteines (XX) influence the redox potential of the active site, determining whether the protein functions primarily as an oxidase, reductase, or isomerase

• The CXXC motif creates a unique microenvironment that allows for specific interaction with substrate proteins

Studies on related proteins like the protein disulfide oxidoreductase from Pyrococcus furiosus (PfPDO) have shown that mutations in the CXXC motif significantly affect catalytic activity . In particular, the CPYC site in the C-terminal half of PfPDO was found to be fundamental to reductive/oxidative activity, while isomerase activity required both active sites . By analogy, the CXXC motif in SO_3870 likely determines its substrate specificity and catalytic efficiency in disulfide bond management within Shewanella oneidensis.

What are the optimal conditions for recombinant expression of SO_3870?

Based on available data, the optimal expression conditions for recombinant SO_3870 involve the following methodology:

• Expression System: E. coli is the preferred expression host, as demonstrated by multiple successful expressions reported in the literature .

• Expression Vector: Vectors incorporating N-terminal tags (particularly His-tags) have been successful for expression and subsequent purification .

• Expression Protocol:

  • Culture E. coli in appropriate medium (typically LB with suitable antibiotics)

  • Induce protein expression at mid-log phase (OD600 of 0.6-0.8)

  • Express at temperatures between 16-30°C to enhance proper folding

  • Harvest cells after 4-16 hours depending on induction temperature

• Buffer Composition: Tris-based buffers (pH 7.5-8.0) with 150 mM NaCl have been used successfully for maintaining protein stability .

It's worth noting that alternative expression systems may be considered for specific applications. For instance, while E. coli remains the most common expression host, yeast-based expression systems have also been successfully employed for SO_3870 production, potentially offering advantages for certain post-translational modifications .

What purification strategies are most effective for obtaining high-purity SO_3870 protein?

The most effective purification strategy for obtaining high-purity SO_3870 protein involves a multi-step approach:

• Affinity Chromatography:

  • For His-tagged proteins: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Typical elution using imidazole gradient (20-500 mM)

  • This step typically achieves >85% purity as determined by SDS-PAGE

• Further Purification (to achieve >95% purity):

  • Size exclusion chromatography (SEC) to separate monomeric protein from aggregates

  • Ion exchange chromatography (IEX) as an optional step to remove remaining contaminants

• Storage Considerations:

  • The purified protein can be stored in Tris-based buffer (pH 7.5-8.0) with 50% glycerol at -20°C/-80°C

  • Addition of reducing agents (e.g., DTT or β-mercaptoethanol) at low concentrations may help maintain protein activity

  • Lyophilization is an alternative for long-term storage, extending shelf life to approximately 12 months at -20°C/-80°C

• Quality Control:

  • Purity assessment by SDS-PAGE (>90% purity recommended for functional studies)

  • Activity assays to confirm that the purified protein retains its redox properties

For optimal results, it is recommended to avoid repeated freeze-thaw cycles and to store working aliquots at 4°C for short-term use (up to one week) .

How can researchers troubleshoot low protein yield or solubility issues during SO_3870 expression?

When encountering low protein yield or solubility issues with SO_3870 expression, researchers can implement several troubleshooting strategies:

• For Low Expression Yield:

  • Optimize codon usage for the expression host

  • Test different promoter systems (T7, tac, etc.)

  • Vary induction conditions (inducer concentration, temperature, duration)

  • Consider co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Test alternative E. coli strains (BL21(DE3), Rosetta, Origami)

• For Poor Solubility:

  • Lower induction temperature (16-18°C) to slow protein synthesis and improve folding

  • Reduce inducer concentration

  • Add solubility-enhancing tags (SUMO, MBP, GST) instead of or in addition to His-tag

  • Include low concentrations of non-ionic detergents (0.05-0.1% Triton X-100) in lysis buffer

  • Test different buffer compositions (pH range 6.5-8.5)

• For Membrane Protein Challenges:
  Since SO_3870 is a putative membrane-associated protein, specialized approaches may be required:

  • Use membrane isolation techniques before affinity purification

  • Consider detergent screening (DDM, LDAO, etc.) for solubilization

  • Apply biotinylation of intact cells with subsequent affinity enrichment, which has been successful for membrane proteome characterization in S. oneidensis

• Expression Validation:

  • Confirm protein expression by Western blot before attempting large-scale purification

  • Use dot blot analysis to rapidly screen multiple expression conditions

  • Consider fusion to fluorescent proteins to visually monitor expression and localization

By systematically addressing these factors, researchers can significantly improve the yield and solubility of recombinant SO_3870 protein for subsequent functional and structural studies.

What enzymatic assays can be used to verify the disulfide oxidoreductase activity of SO_3870?

Several enzymatic assays can be employed to verify and quantify the disulfide oxidoreductase activity of SO_3870:

• Insulin Reduction Assay:

  • Measures reductase activity by monitoring the precipitation of insulin B chain after reduction of disulfide bonds

  • Typically performed by incubating the purified enzyme with insulin in the presence of DTT

  • Activity is measured spectrophotometrically at 650 nm as turbidity increases due to precipitation

• RNase A Refolding Assay:

  • Assesses isomerase activity by monitoring the reactivation of scrambled RNase A

  • Scrambled RNase A contains incorrectly paired disulfide bonds with no enzymatic activity

  • Successful isomerization by SO_3870 restores RNase A activity, which can be measured using standard RNase substrates

• Oxidative Folding of Reduced Proteins:

  • Evaluates oxidase activity using reduced proteins with known disulfide bonds

  • Employs gel-shift assays to monitor the change in mobility between reduced and oxidized forms

  • Can be quantified using Ellman's reagent to detect remaining free thiols

• Synthetic Peptide-Based Assays:

  • Utilizes fluorescent peptides containing strategically placed cysteine residues

  • Disulfide formation or reduction changes the fluorescence properties of the peptide

  • Allows for real-time monitoring of activity with high sensitivity

• In Vivo Functional Complementation:

  • Tests whether SO_3870 can complement E. coli strains deficient in DsbA or DsbC

  • Assesses functionality through restoration of phenotypes such as motility (FlgI disulfide-dependent) or enzymatic activities (like arylsulfate sulfotransferase)

When characterizing SO_3870, it's advisable to employ multiple assays that test different aspects of disulfide oxidoreductase activity (oxidation, reduction, isomerization) to obtain a comprehensive functional profile of the protein.

How does the redox potential of SO_3870 compare to other bacterial disulfide oxidoreductases?

The redox potential of SO_3870 can be compared to other bacterial disulfide oxidoreductases to understand its physiological role and catalytic preferences:

While the exact redox potential of SO_3870 has not been definitively reported in the literature, several inferences can be made based on related proteins:

• The active site CXXC motif in SO_3870 likely influences its redox potential significantly. In related proteins like PDO from hyperthermophiles, different CXXC motifs have been shown to have distinct redox properties .

• If SO_3870 functions similarly to DsbA (oxidase) in E. coli, its redox potential would be expected to be relatively high (less negative), promoting oxidation of substrate proteins.

• Dual functionality (both oxidase and isomerase activities) has been observed in some disulfide oxidoreductases from hyperthermophiles, suggesting that SO_3870 might have a redox potential that allows it to perform multiple functions depending on the cellular environment .

• The estimated conformational energies of the active sites in related proteins suggest that different CXXC sites likely have varying redox properties, potentially allowing for sequential reactions in protein disulfide shuffling .

Further research specifically measuring the redox potential of SO_3870 would be valuable for understanding its physiological role in S. oneidensis and potentially developing biotechnological applications.

What techniques can be used to investigate the substrate specificity of SO_3870?

Investigating the substrate specificity of SO_3870 requires a multi-faceted approach combining various biochemical and biophysical techniques:

• Proteomic Identification of Substrates:

  • Trapping mutants: Create CXXS variants that form stable mixed disulfides with substrates

  • Co-immunoprecipitation followed by mass spectrometry to identify interacting proteins

  • Comparative proteomics between wild-type and SO_3870 knockout strains to identify proteins with altered disulfide status

• Peptide Library Screening:

  • Utilize combinatorial peptide libraries with varying amino acids adjacent to cysteine residues

  • Measure activity against each peptide to determine sequence preferences

  • Develop a consensus motif for substrate recognition

• Structural Analysis of Protein-Substrate Interactions:

  • X-ray crystallography or cryo-EM of SO_3870 in complex with substrates or substrate mimics

  • NMR spectroscopy to map binding interfaces in solution

  • Computational docking to predict binding modes of potential substrates

• Biophysical Interaction Analysis:

  • Surface plasmon resonance (SPR) to determine binding kinetics and affinities

  • Isothermal titration calorimetry (ITC) to measure thermodynamic parameters of binding

  • Microscale thermophoresis (MST) for label-free interaction analysis

• In Vivo Approaches:

  • Bacterial two-hybrid screening to identify interacting proteins

  • Genetic suppressor screens to identify functional relationships

  • In vivo disulfide mapping using techniques like diagonal SDS-PAGE

Research on related protein disulfide oxidoreductases suggests that SO_3870 likely has substrate binding grooves similar to those observed in thioredoxin and PDO enzymes . The residues around the active sites form grooves on the protein surface that likely constitute the substrate binding sites . A model for peptide binding by PDO derived from crystal packing contacts could provide insights into how SO_3870 might interact with its substrates . Additionally, the differential redox properties of the active sites may favor sequential reactions in protein disulfide shuffling, like reduction followed by oxidation .

How does SO_3870 compare to eukaryotic protein disulfide isomerases (PDIs)?

SO_3870 shares several features with eukaryotic protein disulfide isomerases (PDIs) while maintaining distinct bacterial characteristics:

Functional similarities:

• Both SO_3870 and PDIs contain CXXC active site motifs essential for their redox activities .

• Both can catalyze dithiol-disulfide exchange reactions, contributing to proper protein folding .

• Studies on protein disulfide oxidoreductase from Pyrococcus furiosus (PfPDO) suggest it may be related to eukaryotic PDI, potentially representing an evolutionary link .

Significant differences:

• Eukaryotic PDIs have a more complex multi-domain structure compared to the simpler bacterial SO_3870 .

• The cellular localization differs, with PDIs operating in the oxidizing environment of the ER, while SO_3870 functions in the bacterial periplasm or membrane .

• Eukaryotic PDIs often have additional chaperone functions to prevent protein aggregation, which has not been established for SO_3870 .

Research indicates that PDO enzymes in hyperthermophilic Archaea and Bacteria may be part of a complex system involved in the maintenance of protein disulfide bonds, suggesting that SO_3870 might have evolved from a common ancestor with eukaryotic PDIs but has adapted to the specific requirements of bacterial physiology .

What is known about the evolutionary relationship between SO_3870 and other bacterial disulfide oxidoreductases?

The evolutionary relationship between SO_3870 and other bacterial disulfide oxidoreductases reveals interesting patterns of conservation and specialization:

• Phylogenetic Context:

  • SO_3870 belongs to the thioredoxin superfamily, which includes various disulfide oxidoreductases across all domains of life .

  • Genomic analysis suggests that SO_3870 (DsbI) is part of a distinct family of disulfide oxidoreductases that has evolved specialized functions in different bacterial lineages .

• Structural Conservation:

  • The core thioredoxin-like fold with the CXXC motif is highly conserved, reflecting the fundamental importance of this structural element for redox function .

  • The structure of related proteins, like PDO from hyperthermophiles, shows a combination of two thioredoxin-related units with low sequence identity which together form a closed protein domain .

• Functional Divergence:

  • Different bacterial disulfide oxidoreductases have evolved specialized roles in various cellular processes:

    • DsbA: Primary oxidase for disulfide bond formation

    • DsbC: Isomerase that corrects non-native disulfide bonds

    • DsbD: Maintains DsbC in a reduced state

    • SO_3870 (DsbI): Putative specialized oxidoreductase potentially involved in specific pathways

• Taxonomic Distribution:

  • Homologs of SO_3870 are found primarily in proteobacteria, particularly in aquatic bacteria like Shewanella, Vibrio, and Yersinia species .

  • The highest sequence similarities to S. oneidensis proteins, including SO_3870, are found in Vibrio and Yersinia species, reflecting their shared aquatic habitats (marine, riverine, and estuarine environments) .

• Selective Pressures:

  • The diversity of active site disulfides found in PDOs from different organisms suggests adaptation to specific cellular redox environments and substrate preferences .

  • The maintenance of these proteins across diverse bacterial lineages indicates their importance for cellular physiology, particularly in challenging environments where proper protein folding is critical.

Research suggests that SO_3870 may represent an evolutionary adaptation specific to the unique physiological requirements of S. oneidensis, particularly related to its versatile respiratory capabilities and metal-reducing properties that distinguish it from other bacteria .

How does SO_3870 interact with other redox systems in Shewanella oneidensis?

The interaction of SO_3870 with other redox systems in Shewanella oneidensis involves complex networks that maintain proper cellular redox homeostasis:

• Thioredoxin System Interactions:

  • S. oneidensis contains multiple thioredoxins (Trx), with Trx1 identified as the major thiol/disulfide redox system .

  • SO_3870 likely interacts with the thioredoxin system, potentially receiving electrons from or transferring electrons to thioredoxins depending on the cellular redox state .

  • Research has shown that in the absence of Trx1, a glutaredoxin (Grx) system becomes essential under normal conditions, suggesting potential cross-talk between these systems and possibly SO_3870 .

• Membrane Redox Networks:

  • As a putative membrane-associated protein, SO_3870 may interface with membrane-based electron transport systems that are abundant in S. oneidensis .

  • The membrane proteome of S. oneidensis plays a critical role in electron transport processes, and SO_3870 could be involved in maintaining the redox status of membrane proteins .

• Regulatory Interactions:

  • S. oneidensis contains functionally intertwined ROS responsive regulators OxyR and OhrR .

  • While OxyR functions as both an activator and repressor (unlike most OxyRs that function only as activators), OhrR controls response to organic peroxides .

  • The thioredoxin system, particularly Trx1, is required for OxyR to function as a repressor and plays a critical role in the cellular response to organic peroxide by mediating the redox status of OhrR .

  • SO_3870 may participate in these regulatory networks, potentially helping to maintain the proper redox status of these transcription factors.

• Spatial Organization:

  • S. oneidensis biofilms show distinct spatial stratification with respect to metabolism .

  • Within growth-inactive domains of biofilms, genes typically upregulated under anaerobic conditions are expressed well after growth has ceased .

  • SO_3870 might have different roles in different regions of biofilms, potentially contributing to the maintenance of protein function under varying oxygen concentrations and redox states.

The physiological substrates and reduction systems for proteins like SO_3870 remain largely unknown , representing an important area for future research. The regulation of disulfide bond formation likely depends on a distinct interplay of thermodynamic and kinetic effects, including functional asymmetry and substrate-mediated protection of the active sites .

How does SO_3870 contribute to the metal reduction capabilities of S. oneidensis?

SO_3870 likely plays an indirect but significant role in supporting the metal reduction capabilities of S. oneidensis through several mechanisms:

• Maintaining Redox Protein Integrity:

  • As a putative protein-disulfide oxidoreductase, SO_3870 likely ensures proper folding and disulfide bond formation in proteins involved in the electron transport chain .

  • The proper folding of cytochromes and other redox proteins is essential for electron transfer to metal ions during anaerobic respiration .

• Adaptation to Redox Fluctuations:

  • S. oneidensis thrives in redox-stratified environments prone to ROS generation .

  • SO_3870 may help maintain the function of key proteins under varying redox conditions, supporting the bacterium's ability to use diverse terminal electron acceptors .

• Membrane Proteome Support:

  • The membrane proteome plays a critical role in electron transport processes in S. oneidensis .

  • As a membrane-associated protein, SO_3870 could be involved in the proper assembly and maintenance of the membrane-bound electron transport components that are essential for metal reduction .

• Stress Response Coordination:

  • Metal reduction processes can generate reactive oxygen species (ROS) and other stresses .

  • SO_3870 may participate in stress response pathways, potentially working alongside the thioredoxin system to maintain cellular function during metal reduction .

While direct experimental evidence specifically linking SO_3870 to metal reduction capabilities is limited in the current literature, the importance of proper protein folding and disulfide bond management for the function of electron transport proteins suggests that SO_3870 contributes to these processes. Future research specifically examining the effect of SO_3870 deletion or overexpression on metal reduction capabilities would provide valuable insights into its precise role in this significant metabolic pathway of S. oneidensis.

What is the relationship between SO_3870 and the oxidative stress response in S. oneidensis?

The relationship between SO_3870 and oxidative stress response in S. oneidensis involves several interconnected redox systems and regulatory mechanisms:

• Redox Regulation Network:

  • S. oneidensis possesses functionally intertwined ROS responsive regulators OxyR and OhrR that control distinct aspects of oxidative stress response .

  • OxyR in S. oneidensis uniquely functions as both an activator and repressor, controlling genes involved in H₂O₂ scavenging .

  • As a disulfide oxidoreductase, SO_3870 may contribute to maintaining the proper redox status of these transcription factors.

• Integration with Thioredoxin Systems:

  • The major thioredoxin system (particularly Trx1) in S. oneidensis is required for OxyR to function as a repressor and plays a critical role in the cellular response to organic peroxides .

  • SO_3870 potentially works in concert with thioredoxins to maintain cellular redox balance during oxidative stress.

  • While none of the thioredoxin (trx) and glutaredoxin (grx) genes are OxyR-dependent, some are regulated by OhrR, suggesting complex regulation of redox systems in S. oneidensis .

• Disulfide Bond Management:

  • Oxidative stress can lead to non-native disulfide bond formation in proteins .

  • SO_3870, with its putative disulfide isomerase activity, may help correct these non-native bonds, restoring protein function after oxidative damage.

  • This function would be particularly important for maintaining the activity of enzymes involved in ROS detoxification and repair.

• Membrane Integrity Protection:

  • As a membrane-associated protein, SO_3870 may be involved in protecting membrane proteins from oxidative damage .

  • The membrane proteome is especially vulnerable to oxidative stress due to its exposure to both periplasmic and cytoplasmic oxidants.

• Biofilm-Specific Roles:

  • S. oneidensis biofilms show spatial stratification with respect to metabolism, with different redox conditions existing in different regions .

  • SO_3870 might have specialized functions in biofilm formation or maintenance, potentially supporting survival in oxygen-limited regions where anaerobic respiration predominates.

While the precise role of SO_3870 in oxidative stress response has not been fully characterized, its predicted function as a disulfide oxidoreductase suggests it plays an important role in maintaining protein function during redox perturbations. Future studies comparing wild-type and SO_3870 knockout strains under various oxidative stress conditions would help clarify its specific contributions to stress tolerance in S. oneidensis.

How might SO_3870 function differ under aerobic versus anaerobic conditions?

The function of SO_3870 likely adapts to different oxygen availability, with distinct roles under aerobic versus anaerobic conditions:

Under aerobic conditions:

• SO_3870 likely helps form disulfide bonds in newly synthesized proteins, similar to the role of DsbA in other bacteria .

• It may contribute to protection against oxidative stress by ensuring proper folding of antioxidant enzymes .

• The oxidizing environment of the periplasm would favor the oxidized form of the CXXC motif, promoting disulfide bond formation in substrate proteins .

Under anaerobic conditions:

• S. oneidensis can use various terminal electron acceptors, including metals, which requires significant reconfiguration of its respiratory chain .

• SO_3870 may help restructure the disulfide bonding patterns of proteins involved in anaerobic respiration.

• Within biofilms, where anaerobic conditions often prevail in deeper layers, SO_3870 might support the expression of anaerobic genes that continue even after growth has ceased .

• The protein might interact more with components of metal reduction pathways to maintain their functionality in the absence of oxygen .

S. oneidensis is renowned for its versatile respiratory abilities and thrives in redox-stratified environments prone to ROS generation . As a facultative anaerobe capable of surviving and proliferating in both aerobic and anaerobic conditions , S. oneidensis likely depends on flexible redox systems like SO_3870 to maintain protein function across these transitions. The dual functionality observed in related disulfide oxidoreductases (both oxidase and isomerase activities) suggests that SO_3870 may have evolved to support the bacterium's remarkable metabolic versatility across varying oxygen concentrations.

What structural studies would provide deeper insights into SO_3870 function?

Advanced structural studies of SO_3870 would significantly enhance our understanding of its function and mechanism through several complementary approaches:

By combining these structural approaches with functional studies, researchers could develop a comprehensive model of SO_3870's mechanism. For example, related protein disulfide oxidoreductases show a combination of two thioredoxin-related units that together form a closed protein domain with distinct CXXC active site motifs . Understanding whether SO_3870 shares this arrangement would provide valuable insights into its evolutionary relationship with other disulfide oxidoreductases and its specific adaptations to the physiology of S. oneidensis.

How can genetic engineering of SO_3870 enhance its applications in biotechnology?

Genetic engineering of SO_3870 offers several promising avenues for enhancing its biotechnological applications:

• Improved Catalytic Efficiency:

  • Site-directed mutagenesis of residues surrounding the CXXC motif to optimize redox potential

  • Based on studies of related proteins, mutations in the active site can significantly alter catalytic properties

  • Creation of chimeric proteins combining the substrate binding domain of SO_3870 with catalytic domains of other oxidoreductases

• Enhanced Stability for Industrial Applications:

  • Introduction of additional disulfide bonds to increase thermostability

  • Surface engineering to improve solubility and reduce aggregation

  • Fusion with solubility-enhancing tags for maintained activity in harsh conditions

• Substrate Specificity Modification:

  • Directed evolution to generate SO_3870 variants with altered substrate preferences

  • Rational design of the substrate binding groove based on structural data

  • Development of SO_3870 variants specialized for specific biotechnological applications

• Immobilization for Biocatalysis:

  • Engineering specific attachment sites for oriented immobilization on various supports

  • Creation of self-assembling SO_3870 arrays for enhanced stability and reusability

  • Development of SO_3870-based enzymatic cascades for multi-step biotransformations

• Biosensor Development:

  • Engineering SO_3870 to report on cellular redox status through conformational changes

  • Fusion with fluorescent proteins for real-time monitoring of disulfide exchange reactions

  • Development of redox-responsive materials incorporating engineered SO_3870

• Applications in Metal Bioremediation:

  • Engineering SO_3870 to better support the metal reduction capabilities of S. oneidensis

  • Integration with other components of the metal reduction pathway for enhanced activity

  • Development of optimized SO_3870 variants for specific metal contaminants

The potential applications align with S. oneidensis' natural capabilities for bioremediation of toxic compounds like uranium and chromium . By enhancing the stability and activity of SO_3870, researchers could potentially improve the efficiency of metal reduction processes for environmental applications. Additionally, the detailed understanding of substrate recognition and catalytic mechanism gained through protein engineering studies would provide valuable insights into the fundamental biology of disulfide bond management in bacterial systems.

What are the most significant unanswered questions about SO_3870 and how might they be addressed?

Several significant questions about SO_3870 remain unanswered, with potential approaches to address them:

• What are the physiological substrates of SO_3870?

  • Approach: Comparative proteomics between wild-type and SO_3870 knockout strains to identify proteins with altered disulfide status

  • Approach: Development of trapping mutants (CXXS variants) to capture mixed disulfides with substrate proteins

  • Significance: Understanding natural substrates would clarify SO_3870's specific role in S. oneidensis physiology

• What are the redox partners that maintain SO_3870 in its active state?

  • Approach: Pull-down assays coupled with mass spectrometry to identify interacting proteins

  • Approach: Genetic screens to identify synthetic lethal interactions with SO_3870 deletion

  • Significance: Identifying redox partners would complete our understanding of the electron flow pathway

• How is SO_3870 expression and activity regulated in response to environmental conditions?

  • Approach: Transcriptomic and proteomic analysis under various growth conditions (aerobic, anaerobic, metal exposure)

  • Approach: Analysis of post-translational modifications that might regulate activity

  • Significance: Understanding regulation would reveal how SO_3870 contributes to environmental adaptation

• What is the three-dimensional structure of SO_3870 and how does it determine function?

  • Approach: X-ray crystallography or cryo-EM to determine high-resolution structure

  • Approach: Structure-guided mutagenesis to test functional hypotheses

  • Significance: Structural information would enable rational engineering for biotechnological applications

• How does SO_3870 contribute to S. oneidensis' remarkable metal reduction capabilities?

  • Approach: Electrochemical analysis of metal reduction in SO_3870 mutants

  • Approach: Localization studies to determine if SO_3870 associates with metal reduction complexes

  • Significance: Could reveal new strategies for enhancing bioremediation applications

• What is the evolutionary relationship between SO_3870 and other disulfide oxidoreductases?

  • Approach: Comprehensive phylogenetic analysis across bacterial species

  • Approach: Functional complementation studies in diverse bacterial hosts

  • Significance: Would provide insights into the evolution of redox systems in bacteria

• How does SO_3870 function differ in biofilms versus planktonic cells?

  • Approach: Single-cell expression analysis in biofilms of different ages

  • Approach: Spatial proteomics to map SO_3870 activity within structured communities

  • Significance: Could reveal specialized roles in community behavior and persistence

The current literature suggests that numerous questions related to the function of disulfide oxidoreductases in bacteria remain unanswered but can likely be successfully studied through genetic, in vivo, structural, and biochemical approaches . Addressing these questions would not only advance our understanding of SO_3870 specifically but also contribute to broader knowledge about bacterial redox systems and their roles in environmental adaptation and bioremediation applications.