Recombinant Shewanella oneidensis UPF0114 protein SO_3997 (SO_3997)

Shipped with Ice Packs
In Stock

Description

General Information

Shewanella oneidensis MR-1 exhibits remarkable respiratory capabilities and serves as a model organism for bioremediation research . It can adapt and survive under various environmental stresses. Studies involving whole-genome DNA microarrays have been conducted to understand the molecular response of S. oneidensis to heat stress, revealing differential expression of genes, including those encoding hypothetical proteins .

Characteristics of Hypothetical Proteins in S. oneidensis

  • Prevalence: A significant portion of the S. oneidensis genome comprises hypothetical proteins. For example, one study noted that over 41% of the ORFs encode hypothetical proteins, constituting 38% of the changes in gene expression under heat stress .

  • Expression: Transcriptomic and proteomic analyses have identified many hypothetical genes expressed as mRNAs and proteins in S. oneidensis .

  • Functional Assignment: Researchers have used experimental and computational methods to gain insights into the function of these hypothetical genes, identifying homologs and assigning biochemical functions .

Global Expression Profiling

Global expression profiles of S. oneidensis have been determined under various conditions, such as after UV irradiation and during aerobic and suboxic growth . These analyses help identify hypothetical genes expressed under specific conditions .

Adaptive Mutation in S. oneidensis

Studies on the evolution of S. oneidensis under substrate competition have revealed adaptive mutations. For instance, competition with Citrobacter freundii An1 led to more nonsynonymous mutations in S. oneidensis, affecting processes like cellular chemotaxis and amino acid metabolism .

Involvement in Stress Response

Some hypothetical proteins in S. oneidensis are involved in stress responses. For example, heat stress induces the expression of genes encoding hypothetical proteins, suggesting their role in adaptation to elevated temperatures .

Role in Anaerobic Respiration

S. oneidensis can use a broad range of electron acceptors for anaerobic respiration . Gene expression profiling during the switch from aerobic to anaerobic conditions shows differential expression of genes involved in cofactor biosynthesis, substrate transport, and anaerobic energy metabolism .

Impact of Nitrate and Nitrite

Studies have explored the impact of nitrate and nitrite on the physiology of S. oneidensis under aerobic conditions . S. oneidensis employs different oxidases for oxygen respiration and resistance to nitrite .

Involvement in Biofilm Formation

S. oneidensis can form biofilms, and certain proteins play a key role in pellicle formation, affecting biofilm structure and stability .

Presence of Ankyrin-Repeat Containing Proteins

Shewanella species, including sponge-associated bacteria, possess genes encoding ankyrin-repeat containing proteins (ANKs), which may help evade the host immune response .

Prophage and Flagellar Proteins

During heat shock, genes encoding prophage and flagellar proteins show decreased expression. The nature of these proteins in the heat shock response is currently unknown .

Metabolic Pathways and Enzymes

Heat stress can induce enzymes involved in glycolysis and the pentose cycle, suggesting that S. oneidensis utilizes these pathways to ensure the availability of electron carriers during the heat shock response .

Mutant Analysis

Studies involving the creation of deletion mutants have helped to characterize the roles of specific proteins in S. oneidensis. For example, the physiological role of SO3389, a sensory box protein, was characterized through the construction of an in-frame deletion mutant .

Operon Structures

Co-regulation of genes encoding hypothetical proteins suggests operon structures. The consistency of expression of these genes under heat shock conditions provides evidence to support such operon structures .

Expression under Various Conditions

Hypothetical genes are expressed under various conditions, including UV irradiation, aerobic growth, and suboxic growth. This indicates their potential involvement in different cellular processes .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SO_3997; UPF0114 protein SO_3997
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
SO_3997
Target Protein Sequence
MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHILPIIFEMTEVDLVLVTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH LLKIFMDVKNIDNDKIMWYLLIHITFVLSAFAMGYLDKMTRK
Uniprot No.

Target Background

Database Links

KEGG: son:SO_3997

STRING: 211586.SO_3997

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Shewanella oneidensis MR-1 and why is it significant for research?

Shewanella oneidensis MR-1 is a facultatively aerobic Gram-negative bacterium renowned for its remarkably diverse respiratory capacities. While it uses oxygen as the terminal electron acceptor during aerobic respiration like other species, under anaerobic conditions, it can reduce an unusually wide range of alternative terminal electron acceptors. These include oxidized metals (such as Mn(III) and (IV), Fe(III), Cr(VI), U(VI)), fumarate, nitrate, trimethylamine N-oxide, dimethyl sulfoxide, sulfite, thiosulfate, and elemental sulfur. This exceptional respiratory versatility has not been observed in any other organism, making S. oneidensis a critical model organism for bioremediation studies .

What is known about the genomic structure of Shewanella oneidensis MR-1?

The S. oneidensis genome consists of a 4,969,803–base pair circular chromosome containing 4,758 predicted protein-encoding open reading frames (CDSs) and a 161,613–base pair plasmid with 173 CDSs. Genome sequencing has revealed 39 c-type cytochromes, including 32 that were previously unidentified, along with a novel periplasmic [Fe] hydrogenase. These components are integral members of the organism's electron transport system, which underlies its remarkable respiratory versatility .

What is UPF0114 protein SO_3997 and why study it?

UPF0114 protein SO_3997 is one of the thousands of predicted protein-encoding genes in the S. oneidensis genome. The "UPF" designation stands for "Uncharacterized Protein Family," indicating that the precise function of this protein family remains to be fully elucidated. Studying such uncharacterized proteins is crucial for expanding our understanding of S. oneidensis' unique metabolic and respiratory capabilities, particularly as they may relate to the organism's ability to reduce environmental pollutants and participate in extracellular electron transfer .

What plasmid toolkit options are available for expressing SO_3997 in Shewanella oneidensis?

Researchers have developed synthetic plasmid toolkits specifically designed for S. oneidensis MR-1 to facilitate gene expression studies. These toolkits include various expression vectors with combinations of promoters, replicons, antibiotic resistance genes, and an RK2 origin of transfer (oriT). The toolkit components have been characterized for their performance in S. oneidensis, including promoter strength evaluation using green fluorescent protein (GFP) as a reporter. For recombinant expression of proteins like SO_3997, researchers can select from characterized promoters with different strengths and induction properties to optimize expression levels .

How do expression levels compare between various promoters in Shewanella oneidensis?

Researchers have evaluated the strength of various promoters in both E. coli and S. oneidensis MR-1 using GFP as a reporter. For inducible promoters, expression levels can be fine-tuned by adjusting inducer concentrations and induction times. The copy number of different replicons has been quantified using real-time quantitative PCR (RT-qPCR), with findings indicating that copy number directly correlates with GFP fluorescence intensity. This characterization provides valuable guidance for selecting appropriate promoters for expressing recombinant proteins at desired levels .

What are the optimal conditions for inducing expression of recombinant proteins in Shewanella oneidensis?

For inducible promoter systems in S. oneidensis, expression optimization typically involves adjusting parameters such as:

ParameterRange to ConsiderNotes
Inducer concentrationVaries by systemTitration required for each promoter
Induction timingMid-log to late-log phaseEarlier induction may impact growth
Temperature18-30°CLower temperatures may improve folding
Media compositionLB, minimal media, etc.Depends on experimental needs
Aeration conditionsAerobic/anaerobicMay affect protein folding and yield

Optimization should be performed empirically for each recombinant protein, including SO_3997, as optimal conditions may vary depending on protein properties and experimental goals .

What purification strategies are most effective for isolating recombinant SO_3997 protein?

When purifying recombinant SO_3997 from S. oneidensis, researchers should consider a multi-step approach:

  • Cell lysis: Sonication or pressure-based methods in a buffer system that maintains protein stability

  • Initial capture: Affinity chromatography (if a tag such as His6 is incorporated) or ion exchange chromatography

  • Intermediate purification: Size exclusion chromatography to separate oligomeric states

  • Polishing: Additional chromatography steps as needed to achieve desired purity

The purification protocol should be optimized based on the physicochemical properties of SO_3997 and the specific experimental requirements for downstream applications .

How can researchers assess the structural properties of purified SO_3997?

Structural characterization of SO_3997 should employ multiple complementary techniques:

For uncharacterized proteins like SO_3997, combining these approaches provides comprehensive structural insights that can inform functional hypotheses .

How might SO_3997 relate to the electron transport capabilities of Shewanella oneidensis?

Given S. oneidensis' remarkable electron transport capabilities, researchers should investigate whether SO_3997 plays a role in this system. While the search results don't provide specific information about SO_3997's function, we know that S. oneidensis possesses 39 c-type cytochromes and other electron transport components that enable its diverse respiratory capacities. To investigate SO_3997's potential role in electron transport:

  • Generate SO_3997 deletion mutants and assess impacts on electron transfer rates

  • Perform colony-based current-voltage measurements to quantify electrical conductivity in wild-type versus mutant strains

  • Conduct protein-protein interaction studies to identify associations with known electron transport components

  • Analyze expression patterns under different electron acceptor conditions

These approaches can help determine whether SO_3997 contributes to S. oneidensis' distinctive electron transport capabilities .

What techniques can be used to measure the impact of SO_3997 on electrical conductivity in Shewanella oneidensis?

A colony-based current-voltage measurement system has been developed that quantifies bacterial electrical conductivity without requiring biofilm formation on interdigitated array (IDA) electrodes. This approach enables conductivity quantification of gene deletion mutants, making it particularly valuable for studying proteins like SO_3997. The method can be coupled with bipotentiostat measurements to investigate molecular mechanisms underlying electron conduction. This experimental setup offers an advantage over traditional biofilm approaches as it eliminates the confounding factor of biofilm growth on electrodes, allowing for more direct assessment of gene deletion impacts on conductivity .

How does the expression of SO_3997 vary under different respiratory conditions?

To investigate SO_3997 expression patterns:

Respiratory ConditionExperimental SetupMeasurement Method
Aerobic growthStandard aerobic cultureRT-qPCR, proteomics
Anaerobic with fumarateAnaerobic chamber with fumarateRT-qPCR, proteomics
Anaerobic with Fe(III)Anaerobic chamber with Fe(III)RT-qPCR, proteomics
Anaerobic with Mn(IV)Anaerobic chamber with Mn(IV)RT-qPCR, proteomics
Oxygen-limited conditionsControlled O₂ environmentRT-qPCR, proteomics

Comparing expression levels across these conditions can provide insights into whether SO_3997 is involved in specific respiratory pathways or generally upregulated during certain metabolic states .

What strategies are most effective for creating SO_3997 deletion mutants in Shewanella oneidensis?

For creating SO_3997 deletion mutants, researchers can employ several approaches:

  • Homologous recombination using suicide vectors

  • CRISPR-Cas9 genome editing

  • Transposon mutagenesis followed by screening

The synthetic plasmid toolkit developed for S. oneidensis includes components that facilitate these genetic manipulations, such as the RK2 origin of transfer (oriT) that enables conjugation-based plasmid transfer. Researchers should carefully design deletion constructs to avoid polar effects on neighboring genes and include appropriate selection markers for isolating mutants .

How can researchers perform complementation studies to verify phenotypes observed in SO_3997 mutants?

To confirm that phenotypes observed in SO_3997 deletion mutants are specifically due to the absence of SO_3997 rather than polar effects or secondary mutations, complementation studies are essential. The synthetic plasmid toolkit for S. oneidensis provides expression vectors with various promoters that can be used to reintroduce the SO_3997 gene. For rigorous complementation:

  • Clone the wild-type SO_3997 gene with its native promoter

  • Transform the complementation construct into the deletion mutant

  • Verify expression of the complemented gene via RT-qPCR or Western blot

  • Assess whether the wild-type phenotype is restored

  • Include controls with empty vector to rule out vector effects

This approach provides strong evidence for the specific role of SO_3997 in any observed phenotypes .

What phenotypic assays are most informative for characterizing SO_3997 mutants?

When characterizing SO_3997 mutants, researchers should consider multiple phenotypic assays:

Phenotypic ParameterAssay MethodExpected Insights
Growth kineticsGrowth curves in various media and conditionsBasic metabolic functions
Metal reduction ratesFerrozine assay for Fe(III), LBB assay for Mn(IV)Involvement in specific electron transfer pathways
Electrical conductivityColony-based current-voltage measurementsRole in electron conduction
Biofilm formationCrystal violet staining, confocal microscopyContribution to community behaviors
Stress resistanceSurvival under oxidative, pH, temperature stressRole in stress response pathways
Protein-protein interactionsCo-immunoprecipitation, bacterial two-hybridIdentification of interaction partners

This multi-parameter phenotypic profiling can reveal the functional roles of SO_3997 in S. oneidensis physiology .

How can researchers address apparently contradictory findings regarding SO_3997 function?

When faced with seemingly contradictory results about SO_3997 function, researchers should systematically analyze potential sources of variation:

  • Strain differences: Confirm all experiments use the same S. oneidensis strain

  • Experimental conditions: Document and standardize growth conditions, media composition, and sampling times

  • Technical approaches: Compare methodologies used in different studies

  • Data normalization: Evaluate how data was processed and normalized

  • Statistical analysis: Review statistical methods and significance thresholds

For formal contradiction analysis, researchers can categorize the types of contradictions following frameworks used in the biomedical literature. For example, categorizing contradictions as excitatory vs. inhibitory relationships, or positive findings vs. negative findings. This structured approach helps resolve apparent contradictions and may reveal condition-dependent functions of SO_3997 .

What bioinformatic approaches can help predict the function of UPF0114 family proteins like SO_3997?

For uncharacterized proteins like SO_3997, computational approaches can provide valuable functional insights:

Bioinformatic ApproachType of InformationTools/Databases
Sequence homologyRelated proteins across speciesBLAST, HHpred
Structural prediction3D structure modelsAlphaFold2, RoseTTAFold
Domain architectureFunctional domains and motifsInterPro, PFAM
Genomic contextNeighboring genes, operonsSTRING, GeConT
Co-expression analysisGenes with similar expression patternsGEO, Expression Atlas
Molecular dynamicsDynamic properties, binding sitesGROMACS, AMBER
Phylogenetic profilingEvolutionary conservation patternsPhyloPro, EggNOG

Integrating these computational predictions with experimental data provides a more comprehensive understanding of SO_3997 function .

How might SO_3997 contribute to the bioremediation capabilities of Shewanella oneidensis?

Since S. oneidensis is valued for its bioremediation potential, particularly for reducing environmental pollutants like uranium and chromium, researchers should investigate whether SO_3997 contributes to these capabilities. Experimental approaches include:

  • Comparing metal reduction rates between wild-type and SO_3997 mutant strains

  • Measuring bioremediation efficiency in controlled environmental samples

  • Assessing protein expression levels during exposure to various contaminants

  • Investigating protein-protein interactions between SO_3997 and known components of metal reduction pathways

  • Determining the impact of SO_3997 overexpression on bioremediation capabilities

These studies can clarify whether SO_3997 is a potential target for enhancing bioremediation applications .

What are promising approaches for investigating interactions between SO_3997 and microbial communities?

Future research should explore how SO_3997 may influence S. oneidensis interactions within microbial communities:

  • Co-culture experiments with relevant environmental microorganisms

  • Metagenomic analysis of communities with wild-type versus SO_3997 mutant strains

  • Metabolic flux analysis to identify community-level metabolic changes

  • Biofilm structure and composition studies using advanced imaging techniques

  • Transcriptomic analysis to identify community-responsive gene networks

These approaches can reveal whether SO_3997 plays a role in interspecies interactions or community formation, which could impact environmental applications of S. oneidensis .

How might synthetic biology approaches be used to enhance or modify SO_3997 function?

Synthetic biology offers several strategies for engineering SO_3997:

ApproachMethodologyPotential Outcome
Directed evolutionRandom mutagenesis, selectionEnhanced activity, altered specificity
Rational designStructure-guided mutationsOptimized function, new activities
Domain swappingChimeric proteinsNovel functional combinations
Protein scaffoldingCo-localization with partnersEnhanced pathway efficiency
Promoter engineeringModified expression dynamicsOptimized production or activity
Post-translational controlEngineered regulationConditional activity

The synthetic plasmid toolkit for S. oneidensis provides a foundation for implementing these strategies, potentially enhancing bioremediation capabilities or developing new biotechnological applications .

What emerging technologies might advance our understanding of SO_3997 function?

Several cutting-edge technologies promise to deliver new insights into SO_3997 function:

  • Cryo-electron tomography for in situ structural studies

  • Single-cell proteomics to reveal cell-to-cell variation in expression

  • Proximity labeling techniques to identify protein interaction networks

  • Live-cell imaging with fluorescent tags to track localization and dynamics

  • High-throughput phenotyping using microfluidics

  • Machine learning approaches to integrate multi-omics data

  • In-cell NMR to study protein structure and interactions in native environments

These technologies can overcome current limitations in studying uncharacterized proteins and provide unprecedented resolution of SO_3997's role in S. oneidensis physiology .

How does research on SO_3997 contribute to our understanding of bacterial extracellular electron transfer?

Research on SO_3997 contributes to the broader field of bacterial extracellular electron transfer by potentially identifying new components or regulatory factors in this process. S. oneidensis is a model organism for studying these mechanisms, with implications for understanding microbial fuel cells, bioremediation, and geochemical cycling. By thoroughly characterizing previously uncharacterized proteins like SO_3997, researchers can build a more complete model of the molecular machinery underlying S. oneidensis' remarkable electron transfer capabilities .

What are the implications of SO_3997 research for environmental biotechnology applications?

Understanding the function of SO_3997 may reveal new strategies for enhancing S. oneidensis' bioremediation capabilities. If SO_3997 influences electron transfer or metal reduction, manipulating its expression could potentially optimize bioremediation processes. Additionally, insights from SO_3997 research might be transferable to other organisms used in environmental biotechnology, contributing to the development of more effective and versatile bioremediation strategies for addressing environmental pollutants like uranium and chromium .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.