Recombinant Shewanella oneidensis UPF0208 membrane protein SO_2914 (SO_2914)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize your request during development.
Synonyms
SO_2914; UPF0208 membrane protein SO_2914
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
SO_2914
Target Protein Sequence
MSINILKTLGDGRRYMKTWPMVRQLGLYFPEYRVVRATQLAILVMPVLAVLASVSQLYTY GWAFLPQALTIALFFISLPLQGLLWLGWRARHPLPLSLFDWSNQLSAKLTAMGIHCQSLG AKACYLDMALILKIAFERLDASYWEEL
Uniprot No.

Target Background

Database Links

KEGG: son:SO_2914

STRING: 211586.SO_2914

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the recommended methods for extracting and purifying recombinant SO_2914?

Membrane protein extraction and purification require specialized techniques due to their hydrophobic nature. For SO_2914, the following protocol can be adapted based on established membrane protein methodologies:

Extraction Protocol:

  • Cell Lysis and Fractionation:

    • Use a detergent-based selective extraction method such as the Mem-PER Plus Membrane Protein Extraction Kit protocol

    • For bacterial cells like S. oneidensis, follow Protocol 2 (suspension cells):

      • Harvest cells by centrifugation at 300 × g for 5 minutes

      • Wash with Cell Wash Solution

      • Add Permeabilization Buffer and incubate for 10 minutes at 4°C with constant mixing

      • Centrifuge at 16,000 × g for 15 minutes

      • Separate cytosolic proteins (supernatant) from membrane fraction (pellet)

      • Resuspend pellet in Solubilization Buffer and incubate for 30 minutes at 4°C

      • Centrifuge at 16,000 × g for 15 minutes

      • Collect solubilized membrane proteins from supernatant

  • Purification Strategy:

    • Affinity chromatography using a His-tag if the recombinant protein contains this modification

    • Size exclusion chromatography to further purify the protein

    • Ion exchange chromatography as an additional purification step if needed

  • Considerations for Maintaining Protein Integrity:

    • Use mild detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) to maintain native protein conformation

    • Perform all steps at 4°C to minimize proteolytic degradation

    • Include protease inhibitors in all buffers

    • Verify protein integrity by SDS-PAGE and Western blotting

For recombinant production, expression systems should be carefully selected based on the research objectives. E. coli-based systems are common but may require optimization for membrane protein expression.

How can I optimize expression of recombinant SO_2914 in heterologous systems?

Optimizing expression of membrane proteins like SO_2914 presents unique challenges. Consider the following strategies:

Expression System Selection:

  • E. coli strains: C41(DE3) or C43(DE3), specifically designed for membrane protein expression

  • Yeast systems: Pichia pastoris provides a eukaryotic membrane environment

  • Baculovirus-insect cell systems: For larger scale production with post-translational modifications

Expression Optimization Parameters:

  • Induction conditions: Lower temperatures (16-25°C) often improve membrane protein folding

  • Inducer concentration: Use lower IPTG concentrations (0.1-0.5 mM) to reduce aggregation

  • Expression time: Extended expression periods at lower temperatures

  • Media composition: Supplementation with glycerol (0.5-1%) may improve membrane protein yield

Critical considerations:

  • Fusion tags can aid solubility and purification (MBP, SUMO, or GFP tags)

  • GFP fusion allows direct monitoring of folding and membrane integration

  • Codon optimization for the expression host may improve translation efficiency

Monitoring expression through Western blotting or GFP fluorescence at various time points and conditions will help identify optimal protocols specific to SO_2914.

What techniques are most effective for studying membrane topology of SO_2914?

Understanding the membrane topology of SO_2914 is crucial for functional characterization. Several complementary techniques can be employed:

Experimental Approaches:

  • Cysteine scanning mutagenesis:

    • Systematically introduce cysteine residues throughout the protein

    • Use membrane-impermeable/permeable sulfhydryl reagents to determine accessibility

    • This technique can identify which regions are exposed to either side of the membrane

  • Protease protection assays:

    • Expose membrane preparations to proteases

    • Protected fragments indicate membrane-embedded regions

    • Compare protease digestion patterns in intact vs. solubilized membranes

  • Fluorescence-based approaches:

    • GFP fusion analysis at different positions

    • pHluorin tags to determine orientation relative to membrane

  • Computational prediction tools:

    • TMHMM, HMMTOP, or Phobius for transmembrane domain prediction

    • Results from deep mutational scanning studies similar to those described for other membrane proteins can be adapted

  • Epitope tagging:

    • Insert epitope tags at predicted loops

    • Use antibodies to determine accessibility in intact vs. permeabilized cells

A comprehensive topology map would combine data from multiple approaches to build a reliable structural model of SO_2914 in the membrane context.

How can I determine if SO_2914 plays a role in electron transfer in Shewanella oneidensis?

S. oneidensis is renowned for its versatile electron transfer capabilities, particularly in extracellular electron transfer to metals and electrodes . To investigate whether SO_2914 contributes to these processes:

Experimental Approaches:

  • Gene deletion studies:

    • Create a ΔSO_2914 knockout strain using techniques such as the recombineering system described for S. oneidensis

    • Compare electron transfer capabilities between wild-type and mutant strains

    • Measure reduction rates of various electron acceptors (Fe(III), electrodes, etc.)

  • Complementation studies:

    • Reintroduce SO_2914 into the knockout strain to confirm phenotype rescue

    • Use plasmids like pHG101 or pHG102 for genetic complementation as described for other S. oneidensis genes

  • Transcriptional analysis:

    • Use DNA microarrays or RNA-seq to compare expression patterns between wild-type and mutant strains

    • Focus on known electron transfer genes (mtr operon) to identify potential regulatory relationships

    • Compare expression under aerobic vs. anaerobic conditions and with different electron acceptors

  • Protein interaction studies:

    • Use pull-down assays to identify potential interactions with known electron transfer proteins

    • Cross-linking experiments followed by mass spectrometry to identify physical associations

  • Electrochemical measurements:

    • Compare biofilm formation and current production in bioelectrochemical systems

    • Measure electrode reduction rates in wild-type vs. knockout strains

These approaches, particularly when used in combination, can provide compelling evidence regarding the role of SO_2914 in electron transfer processes.

What methodological approaches can determine if SO_2914 is involved in stress response pathways?

S. oneidensis employs various stress response mechanisms, including the general stress response sigma factor σS (RpoS) . To investigate potential involvement of SO_2914 in stress responses:

Experimental Strategy:

  • Stress exposure experiments:

    • Subject wild-type and ΔSO_2914 knockout strains to various stressors:

      • Oxidative stress (hydrogen peroxide, paraquat)

      • Metal stress (elevated concentrations of heavy metals)

      • pH stress (acidic or alkaline conditions)

      • Temperature stress (heat shock, cold shock)

    • Measure growth rates, survival percentages, and morphological changes

  • Gene expression analysis:

    • Use qRT-PCR to quantify SO_2914 expression under different stress conditions

    • Perform RNA-seq to identify global transcriptional changes in ΔSO_2914 mutants

    • Focus on known stress response genes to identify potential regulatory networks

  • Protein-protein interaction studies:

    • Investigate potential interactions with known stress response regulators

    • Test for interactions with CrsA/CrsR partner-switching system that regulates σS

  • Metabolomic analysis:

    • Compare metabolite profiles between wild-type and mutant strains under stress conditions

    • Focus on stress-related metabolites such as reactive oxygen species scavengers

  • Membrane integrity assays:

    • Measure membrane permeability and damage under stress conditions

    • Compare lipid composition between wild-type and mutant strains

Understanding whether SO_2914 functions in stress response pathways would provide valuable insights into its physiological role and potential applications in biotechnology involving Shewanella spp.

What approaches can be used to determine the high-resolution structure of SO_2914?

Determining the structure of membrane proteins like SO_2914 presents unique challenges. Several complementary approaches can be considered:

Structural Determination Methods:

  • X-ray crystallography:

    • Requires purification in detergent micelles or lipidic cubic phases

    • Optimization of crystallization conditions for membrane proteins

    • May require fusion partners or antibody fragments to aid crystallization

    • Resolution typically in the 1.5-3.5 Å range when successful

  • Cryo-electron microscopy (cryo-EM):

    • Increasingly powerful for membrane protein structures

    • Sample preparation in nanodiscs or amphipols

    • Can resolve structures in the 2.5-4 Å range

    • Particularly valuable for proteins resistant to crystallization

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution NMR for smaller membrane proteins or domains

    • Solid-state NMR for proteins in native-like membrane environments

    • Requires isotopic labeling (15N, 13C, 2H)

    • Provides dynamic information not available from static methods

  • Integrative structural approaches:

    • Combine lower-resolution data from multiple sources

    • Incorporate homology modeling with experimental constraints

    • Use deep mutational scanning data to infer structural constraints

    • Apply molecular dynamics simulations to refine structures

For SO_2914 specifically, its relatively small size (16.8 kDa) may make it amenable to solution NMR approaches, though detergent optimization would be critical for success.

How can computational approaches predict structure-function relationships for SO_2914?

Computational methods can provide valuable insights when experimental structural data is limited:

Computational Structure-Function Methods:

  • Homology modeling:

    • Identify structural homologs among characterized membrane proteins

    • Use threading approaches with available UPF0208 family structures

    • Evaluate model quality using metrics like QMEAN or ProSA

  • Molecular dynamics simulations:

    • Simulate protein behavior in membrane environments

    • Identify stable conformations and potential binding sites

    • Study water and ion permeation if SO_2914 functions as a channel

  • Sequence-based prediction tools:

    • Predict functional residues using evolutionary conservation analysis

    • Identify potential transmembrane regions using hydrophobicity analysis

    • Utilize mutual information analysis to detect co-evolving residues

  • Network analysis:

    • Construct protein-protein interaction networks based on experimental data

    • Predict functional associations using tools like STRING

    • Identify potential functional pathways involving SO_2914

  • Deep learning approaches:

    • Use AlphaFold2 or RoseTTAFold to generate structural predictions

    • Apply graph neural networks to predict protein-protein interactions

    • Utilize transfer learning from related membrane proteins

These computational approaches can generate testable hypotheses about SO_2914 function, guiding experimental design and complementing laboratory studies.

How can genetic engineering techniques be optimized to study SO_2914 function in vivo?

Recent advances in genetic engineering provide powerful tools for studying membrane proteins like SO_2914 in their native context:

Genetic Engineering Approaches:

  • Recombineering systems for Shewanella:

    • Utilize the prophage-mediated genome engineering system developed for S. oneidensis

    • This system employs a λ Red Beta homolog from Shewanella sp. W3-18-1 that shows high efficiency

    • Achieve gene modifications with a reported efficiency of ~5 × 10^6 recombinants in 10^8 viable cells

    • Requires only 40-80 nucleotides of homology for efficient recombination

  • CRISPR-Cas9 genome editing:

    • Design efficient sgRNAs targeting SO_2914

    • Optimize transformation protocols for delivery of CRISPR components

    • Incorporate homology-directed repair templates for precise modifications

    • Use counterselection markers to isolate successful edits

  • Fluorescent protein tagging:

    • Create C-terminal or N-terminal fluorescent protein fusions

    • Use superfolder GFP to minimize folding interference

    • Monitor protein localization under different conditions

    • Apply FRAP (Fluorescence Recovery After Photobleaching) to study dynamics

  • Controlled expression systems:

    • Develop inducible promoters optimized for S. oneidensis

    • Create expression gradients to study dose-dependent effects

    • Design reporters to monitor transcriptional and translational regulation

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignments

    • Create alanine-scanning libraries to identify essential regions

    • Design mutations based on computational predictions

These techniques can be combined to create comprehensive experimental frameworks for understanding SO_2914 function in vivo.

How can I apply deep mutational scanning to understand SO_2914 structure and function?

Deep mutational scanning provides a powerful approach to comprehensively map sequence-function relationships in proteins:

Deep Mutational Scanning Methodology:

  • Library creation:

    • Design a comprehensive library of single amino acid substitutions throughout SO_2914

    • Use PCR-based approaches or array-synthesized oligonucleotides

    • Create a library encoding all 19 possible amino acid substitutions at each position

  • Selection system development:

    • Design a selection system that links SO_2914 function to cell growth or survival

    • Potential approaches include:

      • Antibiotic resistance fusion systems similar to the dsTβL approach

      • Coupling to essential electron transfer pathways in S. oneidensis

      • Association with stress response survival under selective conditions

  • High-throughput sequencing:

    • Sequence the mutant library before and after selection

    • Calculate enrichment scores for each variant

    • Generate position-specific scoring matrices

  • Data analysis and interpretation:

    • Create heatmaps showing the effect of each mutation at each position

    • Identify functionally critical residues that don't tolerate substitutions

    • Map tolerance/intolerance patterns onto predicted structures

  • Validation experiments:

    • Individually test critical mutations identified in the screen

    • Correlate mutational sensitivity with structural features

    • Use findings to refine structural models

Analysis of the data can reveal transmembrane regions (high sensitivity to polar substitutions), functional sites (highly conserved, mutation-intolerant regions), and conformationally important residues (showing context-dependent mutational effects) .

What methodologies are available to study SO_2914 in the context of bioelectrochemical systems?

S. oneidensis is extensively studied for its applications in bioelectrochemical systems . To investigate SO_2914's potential role:

Bioelectrochemical System Approaches:

  • Electrode-grown biofilm studies:

    • Compare wild-type and ΔSO_2914 strains in bioelectrochemical reactors

    • Measure current production over time with a potentiostat

    • Analyze biofilm formation and structure using confocal microscopy

    • Conduct electrochemical impedance spectroscopy to characterize electrode-microbe interfaces

  • Transcriptomic analysis:

    • Perform RNA-seq on electrode-grown cells vs. planktonically grown cells

    • Compare expression patterns with other electron acceptors (Fe(III), oxygen)

    • Identify co-expressed genes that may function with SO_2914

  • Protein localization studies:

    • Use immunogold labeling and electron microscopy to localize SO_2914 in electrode-grown cells

    • Determine whether SO_2914 is present in outer membrane extensions or nanowires

    • Monitor dynamics using fluorescently tagged variants

  • Electrochemical techniques:

    • Cyclic voltammetry to identify redox-active components

    • Differential pulse voltammetry for increased sensitivity

    • Chronoamperometry to measure electron transfer rates

  • Direct interspecies electron transfer studies:

    • Investigate the role of SO_2914 in microbial interactions

    • Co-culture experiments with methanogenic archaea or other bacteria

    • Measure interspecies electron transfer efficiencies

These approaches can provide insights into whether SO_2914 contributes to the remarkable extracellular electron transfer capabilities of S. oneidensis, with potential applications in microbial fuel cells and bioelectrosynthesis.

How can multi-omics approaches be applied to understand the functional context of SO_2914?

Integrating multiple omics datasets provides a systems-level understanding of protein function:

Multi-omics Integration Strategy:

  • Transcriptomics:

    • RNA-seq under various conditions to identify co-regulated genes

    • Compare transcriptional profiles between wild-type and ΔSO_2914 strains

    • Identify transcription factors potentially regulating SO_2914

  • Proteomics:

    • Quantitative proteomics to measure protein abundance changes

    • Membrane proteome analysis to identify interacting partners

    • Post-translational modification analysis (phosphoproteomics, etc.)

  • Metabolomics:

    • Identify metabolic changes associated with SO_2914 deletion

    • Target analysis of redox-active metabolites

    • Monitor central carbon metabolism adaptations

  • Fluxomics:

    • 13C metabolic flux analysis to quantify metabolic pathway activities

    • Compare electron flow patterns between wild-type and mutant strains

    • Identify metabolic bottlenecks affecting electron transfer

  • Data integration approaches:

    • Network analysis to identify functional modules

    • Machine learning to predict gene/protein functions

    • Bayesian networks to infer causal relationships

Integration example workflow:

  • Generate transcriptomic, proteomic, and metabolomic data from identical conditions

  • Normalize and process each dataset independently

  • Perform correlation analysis across datasets

  • Construct integrated networks highlighting functional relationships

  • Validate key predictions experimentally

This multi-layered approach can reveal functional contexts that might be missed by single-omics approaches alone.

What computational tools are recommended for analyzing membrane protein data specific to SO_2914?

Several specialized computational tools can aid in analyzing membrane protein data:

Computational Analysis Toolkit:

  • Membrane protein topology prediction:

    • TMHMM, HMMTOP, and Phobius for transmembrane helix prediction

    • SignalP for signal peptide identification

    • CCTOP for consensus topology prediction

  • Structural analysis tools:

    • PPM server for positioning proteins in membranes

    • HOLE for pore/channel analysis if applicable

    • MDAnalysis for simulation trajectory analysis

    • PyMOL or Chimera for structural visualization and analysis

  • Evolutionary analysis:

    • ConSurf for mapping conservation onto structures

    • EVfold for co-evolution analysis

    • CAPS for detecting co-evolving residue networks

  • Functional site prediction:

    • 3DLigandSite for binding site prediction

    • COACH for ligand-binding site prediction

    • Profunc for function prediction from structure

  • Systems biology tools:

    • Cytoscape for network visualization and analysis

    • STRING for protein-protein interaction networks

    • KEGG Mapper for pathway mapping

For SO_2914 specifically, combining these tools can help generate testable hypotheses about structure-function relationships, guide mutagenesis experiments, and place the protein in its broader cellular context.

What are the major challenges in studying UPF0208 family proteins like SO_2914?

Studying uncharacterized membrane proteins presents several significant challenges:

Research Challenges:

  • Functional assignment difficulties:

    • Limited homology to characterized proteins

    • Potential multifunctional nature of membrane proteins

    • Subtle phenotypes that may be condition-dependent

    • Possible redundancy with other membrane proteins

  • Technical challenges:

    • Difficulties in heterologous expression and purification

    • Maintaining native conformation during extraction

    • Limited quantities for biochemical studies

    • Challenges in crystallization for structural studies

  • Methodological limitations:

    • Difficulty creating specific antibodies for detection

    • Limited tools for studying protein dynamics in vivo

    • Challenges in accurately measuring membrane protein interactions

    • Complexity of reconstituting functional membrane proteins in vitro

  • Knowledge gaps:

    • Incomplete understanding of UPF0208 family distribution and evolution

    • Limited structural data for template-based modeling

    • Incomplete characterization of membrane protein biogenesis in S. oneidensis

    • Unknown regulatory mechanisms controlling expression

Addressing these challenges requires innovative approaches combining genetics, biochemistry, and computational methods. Collaborative efforts across disciplines may be particularly valuable for uncharacterized proteins like SO_2914.

What future research directions should be prioritized for understanding SO_2914 function?

Based on current knowledge gaps, several research directions hold particular promise:

Priority Research Directions:

  • Functional genomics screen:

    • Comprehensive phenotypic characterization of ΔSO_2914 under diverse conditions

    • Chemical genomics approaches to identify conditions where SO_2914 becomes essential

    • Synthetic genetic array analysis to identify genetic interactions

  • Structural biology:

    • Determination of high-resolution structure using cryo-EM or X-ray crystallography

    • Investigation of conformational changes under different conditions

    • Structural comparison with other UPF0208 family members

  • System-level analysis:

    • Integration of SO_2914 into models of electron transfer networks

    • Investigation of potential role in biofilm formation and electrode interactions

    • Examination of SO_2914 conservation and variation across Shewanella species

  • Applied research:

    • Exploration of potential biotechnological applications

    • Investigation of SO_2914 manipulation for enhanced bioremediation capabilities

    • Assessment of role in extracellular electron transfer optimization

  • Comparative studies:

    • Analysis across multiple Shewanella species to understand evolutionary conservation

    • Comparison with homologs in other metal-reducing bacteria

    • Investigation of potential horizontal gene transfer events

These directions can be pursued concurrently, with findings from each approach informing and refining the others to build a comprehensive understanding of SO_2914 function.

What is the current consensus on the importance of SO_2914 in Shewanella biology?

While SO_2914 remains largely uncharacterized, several lines of evidence suggest its potential significance:

  • Its conservation across Shewanella species indicates evolutionary importance

  • Its membrane localization places it at the critical interface between cell and environment

  • The remarkable electron transfer capabilities of S. oneidensis involve numerous membrane proteins, suggesting potential involvement of SO_2914

  • Its classification in the UPF0208 family connects it to a broader group of proteins with emerging functional importance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.