Recombinant Shewanella oneidensis UPF0283 membrane protein SO_1811 (SO_1811)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SO_1811; UPF0283 membrane protein SO_1811
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
SO_1811
Target Protein Sequence
MSVELLPHSTEPHANGADKSVSAAARVTQSLKKQQVFDAEQVKLQSATDELKSAQMFAPQ TPITAIDDVVDEALAAHPQALDVESIRPKLHQSRRWSWLARLSLMALLLLTLVQTVLGLR DAWLESPWLFSFYGAVLGIVGSWAIVGVIGEYRKLKRLKQVADTQETGARLALSMQMGEA DGFIDNIVRHYPDSQGLQRLRHSLKDEHNDAEKVLLFEDLVLTERDELAKKIVRRYAAES AVLLAASPLAVLDMAIILWRNQRMLRDVAACYGIELGYWSRIKLIRSIVINIIYAGTSEL VTDLGTQLLSVEMTGKLSARLAQGLGGGLLTARLGYQAMALCRPIRFKDEQRPKLTKVHQ ELLMELKQFAGNLLTKDGRDALKTQLEGTEVNTSSKEKSLS
Uniprot No.

Target Background

Database Links

KEGG: son:SO_1811

STRING: 211586.SO_1811

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Why is SO_1811 of interest to researchers studying bacterial electron transport?

SO_1811 is of particular interest because it belongs to Shewanella oneidensis MR-1, a model organism for studying dissimilatory metal reduction and extracellular electron transfer (EET) . While the specific function of SO_1811 is not fully characterized, it is part of the complex membrane protein network in S. oneidensis that enables this bacterium to use a remarkable diversity of electron acceptors including metals, which has significant implications for bioremediation and microbial fuel cell applications .

The genome of S. oneidensis contains several paralogs of membrane proteins involved in electron transport. Understanding SO_1811 may provide insights into alternative electron transport pathways that exist alongside the well-characterized Mtr pathway .

What are the recommended methods for expressing and purifying recombinant SO_1811?

Expression System Selection:
E. coli is the preferred heterologous host for expressing SO_1811, with BL21(DE3) strains showing good results for membrane protein production . For optimal expression:

  • Clone the SO_1811 gene (complete 1-401 sequence) into an expression vector containing a His-tag for purification

  • Transform into E. coli BL21(DE3) cells

  • Induce expression at OD600 of 0.6-0.8 with IPTG (0.5 mM)

  • Express at lower temperatures (16-20°C) overnight to enhance proper folding of membrane proteins

Purification Protocol:

  • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and protease inhibitors

  • Disrupt cells via sonication or French press

  • Solubilize membrane fraction with appropriate detergent (DDM or LDAO at 1%)

  • Purify using Ni-NTA affinity chromatography

  • Consider size-exclusion chromatography as a secondary purification step

  • Store in Tris buffer with 50% glycerol at -20°C for extended stability

What analytical methods are most effective for characterizing SO_1811 structure and function?

Structural Characterization:

  • Circular Dichroism (CD) spectroscopy for secondary structure assessment

  • Limited proteolysis combined with mass spectrometry for domain mapping

  • Cryo-EM or X-ray crystallography for high-resolution structural determination (though challenging for membrane proteins)

Functional Analysis:

  • Reconstitution into proteoliposomes for transport studies

  • Electron paramagnetic resonance (EPR) spectroscopy to examine potential redox activity

  • Membrane potential measurements in native cells versus knockout strains

  • Electrochemical techniques such as protein film voltammetry to assess electron transfer capabilities, similar to methods used with MtrC and OmcA cytochromes

How does SO_1811 relate to other membrane proteins involved in electron transport in Shewanella oneidensis?

The S. oneidensis genome contains several key membrane protein systems for electron transport, with SO_1811 representing one potential component. The table below compares SO_1811 with better-characterized membrane proteins:

ProteinFamilyKnown FunctionGenomic ContextRelationship to SO_1811
SO_1811UPF0283/DUF697Unknown, likely involved in membrane transportPart of the SO4362-SO4357 gene clusterSubject of this FAQ
MtrBPorin-likeOuter membrane β-barrel protein, facilitates electron transferIn mtrCAB operonPossible functional analog; both are membrane-spanning proteins
MtrEMtrB paralogForms complex with MtrD and MtrF for electron transferIn mtrDEF operonParalog of MtrB that can complement MtrB function
SO4359MtrB-likePutative β-barrel proteinIn same gene cluster as SO_1811Found to complement mtrB mutation in certain conditions
DmsFMtrB-likeComponent of DMSO reduction systemIn operon with genes for DMSO reductaseAnother MtrB paralog with distinct electron acceptor specificity

Research has shown that in some S. oneidensis mutants, the SO4359 protein (in the same gene cluster as SO_1811) could complement MtrB deficiency, suggesting potential functional overlap in membrane-spanning electron transfer .

What experimental evidence exists for the function of SO_1811 in S. oneidensis?

While direct experimental evidence for SO_1811's specific function remains limited, the following observations provide clues:

  • Genomic Context Analysis: SO_1811 is part of a gene cluster (SO4362-SO4357) that includes genes similar to those involved in electron transport .

  • Complementation Studies: Expression of SO4359 and SO4360 (genes in the same cluster as SO_1811) could complement not only an mtrB mutant but also a mutant lacking outer membrane cytochromes, suggesting this gene cluster encodes proteins capable of membrane-spanning electron transfer .

  • Proteomic Evidence: Mass spectrometry has detected SO_1811 in membrane fractions of S. oneidensis grown under anaerobic conditions with ferric citrate as electron acceptor .

  • Structural Predictions: Computational analyses suggest SO_1811 contains transmembrane domains consistent with a membrane transport or channel function .

What approaches are recommended for investigating SO_1811's potential role in extracellular electron transfer?

Genetic Approaches:

  • Generate precise deletion mutants of SO_1811 using CRISPR-Cas9 or lambda Red recombineering

  • Construct complementation strains expressing wild-type and tagged variants

  • Create reporter fusions to monitor expression under various respiratory conditions

  • Perform genetic interaction studies with known components of electron transport chains

Biochemical Approaches:

  • Incorporate purified SO_1811 into proteoliposomes with redox-active dyes to test electron transport capability

  • Use cross-linking studies to identify interaction partners in the membrane

  • Employ fluorescence resonance energy transfer (FRET) to examine proximity to other electron transport components

  • Perform in vitro reconstitution experiments with other purified components of electron transport pathways

Physiological Approaches:

  • Measure growth rates of wild-type versus knockout strains with various electron acceptors

  • Quantify metal reduction rates in comparative studies between wild-type and mutant strains

  • Examine biofilm formation and extracellular electron transfer using electrode-based systems

  • Employ microscopy techniques to localize SO_1811 within the cell membrane during various growth conditions

How can researchers address the challenges of studying membrane proteins like SO_1811?

Solubilization Strategies:

  • Screen multiple detergents systematically (DDM, LDAO, OG, FC-12) for optimal extraction while maintaining native structure

  • Consider newer amphipathic polymers like SMALPs (styrene maleic acid lipid particles) that extract membrane proteins with their native lipid environment

  • Use nanodiscs or bicelles for functional reconstitution studies

Expression Optimization:

  • Test specialized E. coli strains designed for membrane protein expression (C41, C43, Lemo21)

  • Consider homologous expression in Shewanella using inducible promoters

  • Optimize codon usage for the expression host

  • Use fusion partners known to enhance membrane protein folding (e.g., GFP, MBP)

Structural Biology Approaches:

  • Consider solid-state NMR for membrane proteins resistant to crystallization

  • Apply hydrogen-deuterium exchange mass spectrometry for topological information

  • Use single-particle cryo-EM for larger membrane protein complexes

  • Employ computational modeling based on related proteins with known structures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.