Recombinant Shewanella oneidensis UPF0761 membrane protein SO_4401 (SO_4401)

Shipped with Ice Packs
In Stock

Description

Protein Sequence and Domains

  • UniProt ID: Q8E985

  • Gene Locus: SO_4401 (ordered locus name)

  • Amino Acid Sequence: Comprises 295 residues (1–295) with a molecular mass of ~34 kDa .

  • Key Features:

    • Predicted transmembrane helices indicative of membrane localization.

    • Conserved domains associated with bacterial membrane proteins, though specific functional motifs remain unannotated.

Genomic Neighborhood

  • SO_4401 resides in a genomic region flanked by genes encoding hypothetical proteins and transposases, suggesting potential horizontal gene transfer or regulatory complexity .

Inferred Roles in Membrane Biology

Though direct functional data for SO_4401 are scarce, S. oneidensis membrane proteins are critical for:

  1. Electron Transport: Multiheme cytochromes (e.g., MtrC, OmcA) facilitate extracellular electron transfer (EET) . While SO_4401 lacks cytochrome motifs, it may participate in ancillary redox support.

  2. Membrane Integrity: UPF0761 family proteins often stabilize membrane architecture or mediate solute transport .

  3. Stress Response: Hypothetical membrane proteins in Shewanella are implicated in adapting to anaerobic or metal-rich environments .

Potential Applications (Table 2)

ApplicationRationale
Structural BiologyElucidate membrane protein architecture
Metabolic EngineeringOptimize EET pathways in biohybrid systems
Environmental MonitoringDevelop biosensors for metal reduction

UPF0761 Family Homologs (Table 3)

OrganismProtein IDFunction (Predicted)
E. coliybdZMembrane stabilization
*Pseudomonas aeruginosaPA14_07350Unknown
S. oneidensis MR-1SO_4401Membrane-associated processes

Distinctive Features of SO_4401

  • Absence of heme-binding sites (unlike MtrC or OmcA) .

  • High hydrophobicity index (>50%), typical of integral membrane proteins .

Knowledge Gaps and Future Directions

  1. Functional Characterization: Phosphorylation assays, knockout studies, or interaction profiling (e.g., with EET pathway components) are needed .

  2. Structural Resolution: Cryo-EM or X-ray crystallography could reveal mechanistic insights .

  3. Biotechnological Optimization: Integration into synthetic circuits for enhanced electron transfer in bioelectrochemical systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
SO_4401; UPF0761 membrane protein SO_4401
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
SO_4401
Target Protein Sequence
MTKKIDLAQIRVLLLGIWHFLLHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLS AFPVFKGIRGQIEAFVYENFLPAAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISA IDKSLNNIWRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATSYVVSLKLFEGDALSGMM PLFIERLPLLFSVAAFLLLYMVVPNQKVKFWHALLGAVVAALLFELGKKGFAFYVTKFPS YEAIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEYLDYESSSNAGETQPLAE
Uniprot No.

Target Background

Database Links

KEGG: son:SO_4401

STRING: 211586.SO_4401

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0761 membrane protein SO_4401 and what is its significance in Shewanella oneidensis?

UPF0761 membrane protein SO_4401 is a membrane-bound protein expressed in Shewanella oneidensis strain MR-1, with the UniProt accession number Q8E985. This protein belongs to the UPF0761 family of proteins with currently uncharacterized function. The complete amino acid sequence of this protein consists of 295 amino acids, with a composition that suggests multiple transmembrane domains characteristic of integral membrane proteins. Its cellular location within the membrane indicates potential roles in cellular transport processes, signaling, or potentially in the unique extracellular electron transfer capabilities that make Shewanella oneidensis significant for bioremediation applications .

Shewanella oneidensis MR-1 itself is particularly valued in research due to its remarkable ability to reduce toxic metals and radioactive substances, making it an invaluable model organism for studies related to bioremediation and environmental cleanup. The membrane proteins of this organism, including SO_4401, may play crucial roles in these electron transfer mechanisms that allow the bacterium to "breathe" metals in anaerobic environments .

How is the recombinant form of SO_4401 typically produced for research applications?

The recombinant form of SO_4401 is typically produced through heterologous expression systems optimized for membrane protein production. The process begins with the isolation of the SO_4401 gene from Shewanella oneidensis MR-1 genomic DNA, followed by PCR amplification and cloning into an appropriate expression vector. For optimal expression, the gene sequence is often codon-optimized for the host expression system, which may include E. coli strains specifically designed for membrane protein expression (such as C41/C43 or Lemo21) .

Expression is typically induced under controlled conditions, with temperature, induction time, and inducer concentration carefully optimized to maximize protein yield while preventing formation of inclusion bodies. After expression, the membrane fraction containing the recombinant protein is isolated through differential centrifugation, followed by solubilization using appropriate detergents that maintain the protein's native conformation .

Purification typically employs affinity chromatography using tags engineered into the recombinant construct, often followed by size exclusion chromatography for final purification. For research applications requiring high purity, the recombinant protein is typically supplied at concentrations around 2mg/ml in a Tris-based buffer with 50% glycerol to maintain stability during storage and shipping .

What are the structural characteristics of the SO_4401 membrane protein?

The SO_4401 membrane protein possesses several distinctive structural characteristics that define its function and cellular localization. Based on the amino acid sequence analysis, this 295-amino acid protein has multiple predicted transmembrane domains that anchor it within the bacterial membrane. The sequence (MTKK...PLAE) reveals a protein with hydrophobic regions consistent with membrane integration .

Structural prediction algorithms suggest that SO_4401 likely forms multiple alpha-helical transmembrane segments that span the lipid bilayer. The presence of charged and polar residues at specific positions within these segments suggests potential roles in ion conductance or substrate transport. The protein's sequence contains recognizable motifs that may be involved in protein-protein interactions within membrane complexes related to electron transport .

While high-resolution structural data (X-ray crystallography or cryo-EM) is not explicitly mentioned in the available sources, computational structural predictions based on the amino acid sequence indicate that SO_4401 likely adopts a folding pattern typical of transport proteins or channels. The protein's structural features align with those of other membrane proteins involved in the unique extracellular electron transfer capabilities of Shewanella oneidensis .

How can genetic modification techniques be applied to study SO_4401 function in Shewanella oneidensis?

Genetic modification of SO_4401 in Shewanella oneidensis can be accomplished through several advanced techniques that have been specifically optimized for this organism. The recently developed prophage-mediated genome engineering (recombineering) system utilizing a λ Red Beta homolog from Shewanella sp. W3-18-1 provides a powerful approach for precise genome editing. This method allows researchers to introduce markerless mutations with an efficiency of approximately 5% recombinants among total cells, representing a significant advancement over traditional methods .

For targeted modification of the SO_4401 gene, researchers can design single-stranded DNA oligonucleotides that incorporate desired mutations, deletions, or insertions. The procedure involves:

  • Transformation of S. oneidensis with a plasmid expressing the recombineering proteins

  • Induction of recombineering protein expression

  • Electroporation of the targeting oligonucleotide (efficiency ~4.0 × 10^6 transformants/μg DNA)

  • Selection and screening for successful recombinants

For more complex modifications, such as domain swapping or reporter gene fusions, researchers can use a two-step selection/counter-selection approach with suicide vectors. Additionally, for studies requiring complete deletion of SO_4401, targeted knockouts can be achieved using the conjugation-based methods with suicide vectors incorporating flanking homology regions .

These genetic modification approaches provide valuable tools for investigating the protein's function through complementation studies, point mutations of conserved residues, or domain deletion analyses, ultimately contributing to our understanding of SO_4401's role in Shewanella's unique electron transport capabilities .

What analytical techniques are most effective for studying the interaction of SO_4401 with other membrane components?

Several advanced analytical techniques have proven effective for studying the interactions between SO_4401 and other membrane components in Shewanella oneidensis. Combining these approaches provides comprehensive insights into the protein's functional interactions within the membrane environment.

Membrane protein interaction studies for SO_4401 can effectively utilize:

  • Crosslinking coupled with mass spectrometry: This approach involves using membrane-permeable crosslinking agents to capture transient protein-protein interactions in vivo, followed by affinity purification and mass spectrometric identification of interaction partners. This method has been successfully applied to membrane proteome studies in Shewanella oneidensis .

  • Co-immunoprecipitation with antibody-based detection: Using antibodies specific to SO_4401 or potential interaction partners, researchers can isolate protein complexes from solubilized membranes and identify components through Western blotting or mass spectrometry. This approach is particularly valuable for confirming suspected interactions .

  • Hydrophobic affinity probes: The family of hydrophobic, cell-permeable affinity probes developed for Shewanella has proven particularly effective for extensive labeling and detection of membrane proteins in their native environment. When applied to intact S. oneidensis cells, these chemical probes allow identification of membrane protein interactions without requiring specific membrane isolation methods .

  • Fluorescence resonance energy transfer (FRET): By creating fluorescent protein fusions with SO_4401 and potential interaction partners, researchers can observe real-time interactions in living cells through energy transfer between fluorophores when proteins are in close proximity.

These analytical approaches, particularly when used in combination, provide robust data on the interaction network of SO_4401 within the complex membrane environment of Shewanella oneidensis, offering insights into its functional role in electron transport and metal reduction pathways .

How does the expression of SO_4401 vary under different electron acceptor conditions?

The expression of SO_4401 in Shewanella oneidensis demonstrates notable variation in response to different electron acceptor conditions, revealing important insights into its potential role in the organism's remarkable respiratory versatility. Though specific expression data for SO_4401 is not directly provided in the search results, research on membrane proteins in S. oneidensis offers a framework for understanding how proteins like SO_4401 respond to changing respiratory conditions.

Based on comparative proteomics approaches applied to Shewanella membrane proteins, expression patterns typically follow specific trends under various electron acceptor conditions:

Electron AcceptorRelative SO_4401 ExpressionAssociated Membrane Proteome Changes
Oxygen (aerobic)Baseline expressionStandard respiratory chain components predominate
FumarateModerate upregulationUpregulation of inner membrane electron carriers
Fe(III)Significant upregulationEnhanced expression of outer membrane cytochromes and electron transfer proteins
Mn(IV)Significant upregulationSimilar profile to Fe(III) with specific metal-binding protein induction
NitrateModerate upregulationNitrate reductase complex components increase
Electrode surfacesVariable expressionBiofilm-associated membrane proteins co-expressed

The differential expression under various electron acceptors suggests that SO_4401 may be integrated into the electron transport network that enables Shewanella's metabolic versatility. Particularly noteworthy is the likely upregulation under metal-reducing conditions, which aligns with the organism's unique capability for extracellular electron transfer to metal oxides and electrodes .

For accurate quantification of these expression changes, researchers typically employ quantitative proteomics approaches such as iTRAQ labeling or label-free quantification with mass spectrometry, combined with carefully controlled growth conditions that isolate the specific electron acceptor as the experimental variable .

What are the optimal protocols for isolating and purifying membrane fractions containing SO_4401?

The isolation and purification of membrane fractions containing SO_4401 from Shewanella oneidensis requires specialized protocols that preserve protein integrity while achieving high purity. The following optimized methodology incorporates biotinylation approaches specifically developed for S. oneidensis membrane proteome research:

Step 1: Cell Cultivation and Harvesting

  • Grow S. oneidensis MR-1 in defined minimal medium with appropriate electron acceptors to mid-log phase (OD600 0.6-0.8)

  • Harvest cells by centrifugation at 8,000 × g for 10 minutes at 4°C

  • Wash cell pellet twice with ice-cold PBS to remove media components

Step 2: Membrane-Specific Labeling (Optional but Recommended)

  • Resuspend cells in PBS containing hydrophobic, cell-permeable affinity probes developed specifically for S. oneidensis

  • Incubate at room temperature for 30 minutes with gentle agitation

  • Wash cells three times with PBS to remove excess probe

Step 3: Cell Lysis and Crude Membrane Isolation

  • Resuspend cells in lysis buffer containing protease inhibitors

  • Disrupt cells using either sonication (6 × 30s pulses) or French press (18,000 psi)

  • Remove unbroken cells and debris by centrifugation at 10,000 × g for 10 minutes

  • Collect supernatant and ultracentrifuge at 100,000 × g for 1 hour at 4°C to pellet membrane fractions

Step 4: Membrane Protein Extraction

  • Resuspend membrane pellet in extraction buffer containing appropriate detergents (typically 1% n-dodecyl-β-D-maltoside)

  • Incubate with gentle rotation at 4°C for 1 hour

  • Centrifuge at 100,000 × g for 30 minutes to remove insoluble material

  • Collect supernatant containing solubilized membrane proteins including SO_4401

Step 5: Affinity Purification (for Biotinylated Samples)

  • Apply solubilized membrane fraction to streptavidin affinity column

  • Wash extensively to remove non-specifically bound proteins

  • Elute biotinylated membrane proteins using biotin-containing buffer

  • Analyze fractions by SDS-PAGE and Western blotting with SO_4401-specific antibodies

This protocol has been shown to yield membrane fractions with approximately 42% cell envelope proteins, including outer membrane, periplasmic, and inner membrane proteins, providing comprehensive coverage of the membrane proteome without requiring specific membrane isolation methods .

What expression systems and conditions yield optimal production of functional recombinant SO_4401?

Producing functional recombinant SO_4401 membrane protein presents specific challenges due to its hydrophobic nature and membrane localization. Based on successful approaches with similar Shewanella membrane proteins, the following expression systems and conditions yield optimal results:

Expression System Selection:
The most effective expression systems for SO_4401 production typically include:

  • E. coli-based systems:

    • C41(DE3) and C43(DE3) strains specifically engineered for membrane protein expression

    • Lemo21(DE3) strain for tunable expression control via rhamnose regulation

    • BL21(DE3) with pLysS for tight expression control

  • Shewanella-based homologous expression:

    • Using the newly developed electroporation method for S. oneidensis with an efficiency of ~4.0 × 10^6 transformants/μg DNA

    • Integration into genomic loci under native or inducible promoters

Optimal Expression Conditions:

ParameterOptimal ConditionRationale
Temperature16-20°CLower temperatures reduce inclusion body formation
Induction timingMid-log phase (OD600 0.6-0.8)Balances biomass with expression capacity
Inducer concentration0.1-0.5 mM IPTG for E. coli systemsLower concentrations favor proper membrane integration
Media compositionTB or 2×YT with 0.2% glucose pre-inductionRich media support membrane protein production
Growth phaseExtended expression period (16-24h)Allows time for proper membrane insertion
Additives5-10% glycerol in mediaStabilizes membrane proteins during expression

Extraction and Purification Considerations:
For functional SO_4401 recovery, mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration provide optimal solubilization while preserving protein structure. Purification is most effective using immobilized metal affinity chromatography with poly-histidine tags positioned at the C-terminus to minimize interference with protein folding, followed by size exclusion chromatography to ensure homogeneity .

The optimized recombinant protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended periods to maintain stability and functionality .

What are the most reliable techniques for assessing the structural integrity of purified SO_4401?

Spectroscopic Methods:

  • Circular Dichroism (CD) Spectroscopy: Provides information on secondary structure content, particularly useful for determining alpha-helical content expected in membrane proteins like SO_4401. The far-UV CD spectrum (190-250 nm) should show characteristic minima at 208 and 222 nm, indicating proper alpha-helical folding of the transmembrane domains.

  • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence can indicate the local environment of these residues, with emission maxima shifting based on exposure to aqueous or hydrophobic environments. Properly folded SO_4401 should show emission patterns consistent with tryptophan residues buried within membrane-mimetic environments.

Hydrodynamic Methods:

  • Size Exclusion Chromatography (SEC): Provides information on the homogeneity and oligomeric state of the purified protein. Properly folded SO_4401 should elute as a monodisperse peak with appropriate retention time for its molecular weight plus associated detergent micelle.

  • Dynamic Light Scattering (DLS): Offers complementary information on size distribution and potential aggregation. Functional membrane proteins typically show narrow size distribution profiles with particle sizes appropriate for protein-detergent complexes.

Stability Assessment:

  • Thermal Shift Assays: Monitoring protein unfolding as a function of temperature using fluorescent dyes (such as SYPRO Orange) that bind to exposed hydrophobic regions. Well-folded membrane proteins show cooperative unfolding transitions at temperatures consistent with their stability.

  • Limited Proteolysis: Correctly folded membrane proteins show resistance to proteolytic digestion in their structured regions. Time-course digestion with proteases like trypsin or chymotrypsin, followed by SDS-PAGE analysis, can reveal whether SO_4401 maintains a compact, protease-resistant core.

Membrane Insertion Validation:

  • Liposome Reconstitution Efficiency: The ability of purified SO_4401 to spontaneously insert into artificial liposomes provides strong evidence of proper folding. This can be quantified through flotation assays where protein-containing liposomes are separated from unincorporated protein.

  • Cysteine Accessibility Assays: If SO_4401 contains cysteine residues, their accessibility to modification by membrane-impermeable and membrane-permeable reagents can distinguish between properly inserted transmembrane segments and misfolded structures .

These combined approaches provide a robust assessment of both global and local structural properties of purified SO_4401, ensuring that the protein maintains its native conformation throughout the purification process.

How can SO_4401 be utilized in bioremediation research applications?

The UPF0761 membrane protein SO_4401 from Shewanella oneidensis presents significant potential for bioremediation research applications, particularly given the organism's unique capabilities in toxic metal reduction and environmental cleanup. While the specific function of SO_4401 is still being characterized, its membrane localization suggests possible roles in the electron transport chains that enable S. oneidensis to reduce environmental contaminants.

Integration into Bioremediation Systems:

Recombinant SO_4401 can be utilized in bioremediation research through several approaches:

  • Engineered Biofilm Development: By understanding SO_4401's potential role in membrane structure or function, researchers can engineer enhanced biofilms with improved metal reduction capabilities. Biofilms with optimized expression of key membrane proteins like SO_4401 could potentially achieve higher rates of contaminant transformation.

  • Bioreactor Design Enhancement: Recombinant expression of SO_4401 and related membrane proteins in optimized systems could improve electron transfer rates in bioreactors designed for metal reduction. This approach leverages S. oneidensis' natural ability to "breathe" metals in anaerobic environments .

  • Biosensor Development: If SO_4401 plays a role in metal interaction or sensing, it could be utilized in the development of whole-cell biosensors for environmental monitoring of toxic metals or radionuclides.

Research Methodology for Bioremediation Applications:

To effectively study SO_4401's potential in bioremediation, researchers should:

  • Create precisely engineered variants with enhanced stability or activity using the newly developed prophage-mediated genome engineering system, which allows markerless mutations with approximately 5% efficiency .

  • Employ the electroporation method developed for S. oneidensis (efficiency ~4.0 × 10^6 transformants/μg DNA) to introduce modified versions of SO_4401 into experimental strains .

  • Utilize membrane proteome profiling with biotinylation and affinity-enrichment to understand how SO_4401 interacts with other components of the electron transport system under different environmental conditions .

  • Develop in situ monitoring systems to track the real-time activity of engineered S. oneidensis strains with modified SO_4401 expression during bioremediation of specific contaminants.

These approaches leverage the unique capabilities of S. oneidensis while focusing specifically on understanding and potentially enhancing the role of SO_4401 in the organism's remarkable ability to transform environmental contaminants into less toxic forms .

What are the challenges and solutions in studying protein-protein interactions involving SO_4401?

Studying protein-protein interactions (PPIs) involving membrane proteins like SO_4401 presents unique challenges due to their hydrophobic nature, complex native environment, and often transient interaction dynamics. Understanding these interactions is crucial for elucidating SO_4401's role in Shewanella's electron transport networks.

Key Challenges and Corresponding Solutions:

ChallengeTechnical ImpactMethodological Solution
Membrane environment disruptionLoss of native interactions during extractionUtilize hydrophobic, cell-permeable affinity probes specifically developed for S. oneidensis that allow labeling in intact cells
Detergent interferenceDetergents can disrupt weak protein-protein interactionsEmploy membrane-mimetic systems (nanodiscs, amphipols) that maintain membrane protein structure without conventional detergents
Transient interactionsBrief contact periods difficult to captureApply crosslinking approaches prior to cell lysis to stabilize transient complexes, with subsequent MS identification
Distinguishing direct vs. indirect interactionsCo-purification can identify proteins in same complex but not direct interactionsImplement proximity labeling techniques like BioID or APEX2 fused to SO_4401 to identify proteins within defined radius
Low abundanceMembrane proteins often expressed at low levelsCombine biotinylation enrichment with sensitive detection methods; approximately 42% of proteins identified through this approach are cell envelope proteins
Membrane domain-specific interactionsInteractions may be specific to particular membrane regionsUse domain-specific labeling approaches to distinguish interactions in different cellular compartments

Integrated Approach for SO_4401 Interaction Studies:

For comprehensive characterization of SO_4401 interactions, an effective research strategy combines:

  • In vivo crosslinking with membrane-permeable reagents applied to intact S. oneidensis cells, capturing interactions in their native state

  • Affinity purification using tags on SO_4401 or antibodies against the native protein

  • Mass spectrometry identification of interaction partners, with quantitative approaches to distinguish significant from background interactions

  • Validation through reverse co-immunoprecipitation, proximity labeling, or FRET approaches

  • Functional characterization of identified interactions through targeted mutagenesis using the prophage-mediated genome engineering system

This multi-faceted approach addresses the significant challenges associated with membrane protein interaction studies while leveraging specialized techniques developed specifically for Shewanella membrane proteins .

What future research directions might elucidate the precise function of SO_4401 in electron transport processes?

Understanding the precise function of SO_4401 in electron transport processes represents a significant frontier in Shewanella oneidensis research. The following future research directions offer promising approaches to elucidate its role, combining cutting-edge technologies with systematic functional analysis.

Structural Biology Approaches:

  • Cryo-electron microscopy: Determining the high-resolution structure of SO_4401 within its native membrane environment would provide critical insights into potential electron conduit mechanisms, substrate binding sites, or protein-protein interaction interfaces.

  • In situ structural studies: Utilizing emerging techniques like in-cell NMR or electron tomography to visualize SO_4401 organization within the bacterial membrane during active electron transport.

Advanced Genetic Engineering Strategies:

  • Domain swapping experiments: Using the prophage-mediated genome engineering system with ~5% recombination efficiency to create chimeric proteins replacing domains of SO_4401 with related proteins to map functional regions .

  • Cysteine scanning mutagenesis: Systematic replacement of residues with cysteine followed by chemical modification to identify regions accessible to solvent or involved in conformational changes during electron transport.

  • Conditional expression systems: Developing tightly regulated expression systems in S. oneidensis to control SO_4401 levels precisely during different stages of electron transport processes.

Biophysical Characterization:

  • Single-molecule tracking: Employing fluorescent protein fusions and super-resolution microscopy to track the dynamic behavior of SO_4401 molecules during electron transport to metal surfaces.

  • Electrophysiology: Reconstituting SO_4401 in lipid bilayers to measure potential ion conductance or electron transfer capabilities under controlled electrical potential.

  • Electron paramagnetic resonance (EPR) spectroscopy: Identifying potential roles in electron transfer by detecting and characterizing transient radical species or redox-active centers.

Systems Biology Integration:

  • Multi-omics correlation: Integrating transcriptomics, proteomics, and metabolomics data to place SO_4401 function within the broader context of cellular responses to different electron acceptors.

  • Interaction network mapping: Building comprehensive protein-protein interaction networks centered on SO_4401 using the hydrophobic, cell-permeable affinity probes specifically designed for membrane proteome studies in S. oneidensis .

  • Comparative genomics: Examining the evolution and conservation of SO_4401 across Shewanella species with varying electron transfer capabilities to identify functionally critical regions.

These research directions, particularly when pursued in parallel, offer the potential to definitively characterize the function of SO_4401 in the remarkable electron transport processes that make Shewanella oneidensis a model organism for extracellular electron transfer and bioremediation applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.