Recombinant Shewanella pealeana ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Shewanella pealeana ATP synthase subunit a (atpB) is a bacterially expressed protein derived from the marine bacterium Shewanella pealeana. This subunit is a critical component of the ATP synthase complex (F0_0F1_1 ATP synthase), which catalyzes ATP production via oxidative phosphorylation. The recombinant protein corresponds to the full-length sequence (1–276 amino acids; UniProt ID: A8HAG9) fused to an N-terminal hexahistidine (His) tag for purification and detection purposes .

Functional Role

ATP synthase subunit a (atpB) is integral to the F0_0 sector of the ATP synthase complex, facilitating proton translocation across the membrane to drive ATP synthesis. In Shewanella pealeana, this enzyme supports energy metabolism under diverse respiratory conditions, including anaerobic metal reduction .

Research Applications

  • Biochemical Studies: Used to investigate ATP synthase mechanics in metal-reducing bacteria .

  • Structural Biology: Serves as a template for crystallography or cryo-EM studies due to its full-length, tagged design .

  • Enzyme Kinetics: Enables analysis of proton-coupled ATP synthesis in extremophiles .

Production and Quality Control

  • Expression System: Optimized in E. coli for high yield and solubility .

  • Purification: Affinity chromatography via His tag, followed by gel filtration .

  • Storage Recommendations:

    • Lyophilized protein stable at -20°C/-80°C.

    • Reconstitution in sterile water with 50% glycerol for long-term storage .

Biological Context in Shewanella pealeana

Shewanella pealeana is a Gram-negative, facultative anaerobe isolated from the accessory nidamental gland of the squid Loligo pealei. Key traits include:

  • Metabolic Versatility: Utilizes lactate, acetate, or pyruvate as energy sources under aerobic conditions .

  • Electron Acceptor Diversity: Reduces iron, manganese, nitrate, and sulfur compounds anaerobically .

  • ATP Synthase Adaptation: Functions optimally in marine environments with fluctuating oxygen and salinity .

Comparative Analysis of ATP Synthase Subunits

SubunitGeneLength (aa)Function
Subunit aatpB276Proton channel in F0_0 sector
Subunit catpE84Rotor ring formation in F0_0

Key Research Findings

  • Proton Translocation Efficiency: Subunit a’s transmembrane helices are critical for coupling proton motive force to ATP synthesis .

  • Environmental Adaptation: S. pealeana ATP synthase operates under high salinity, aligning with its marine habitat .

  • Resistance to Oxidative Stress: The enzyme maintains activity in redox-variable environments, a trait leveraged in bioremediation studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
atpB; Spea_4246; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Target Names
atpB
Target Protein Sequence
MATTGDDTLTVTASDYIQHHLTNAKMCSADGGIAFNYACQDAGFWTWHIDSLLFSVGLGV LFLWLFYKVGQKATIGVPGKLQCFVEMCVEGVDKIVKDSFHGKNAVIAPLGLTIFVWVFL MNLMDLIPVDFVPEAAKRFLGVPYLKIVPTTDLNVTLGLALSVFALIVFYSIKVKGIGGF TKELTMQPFNHWALIPINFVLETVTLVAKPISLSLRLFGNLYAGELIFILIALMPWWAQF ALSVPWAIFHILVIVLQAFIFMMLTIVYLSMAHEDH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in Shewanella pealeana?

ATP synthase subunit a (atpB) in S. pealeana is a critical component of the F₀ domain that is embedded within the membrane. This subunit forms part of the proton channel that facilitates H⁺ ion movement across the membrane, which drives the conformational changes in the F₁ catalytic domain necessary for ATP synthesis. The subunit a works in conjunction with the c-ring to create the rotary mechanism that couples proton translocation to ATP synthesis . In Shewanella species, ATP synthase plays a crucial role in energy conservation during both aerobic and anaerobic respiration, allowing these bacteria to thrive in redox-stratified environments by utilizing various terminal electron acceptors .

How does ATP synthase function differ between Shewanella species and model organisms?

Shewanella species demonstrate remarkable respiratory versatility compared to model organisms like E. coli. While the core ATP synthase structure remains conserved, Shewanella's enzyme must operate efficiently under diverse respiratory conditions:

FeatureShewanella ATP SynthaseE. coli ATP Synthase
Respiratory conditionsFunctions with diverse terminal electron acceptors including metals, electrodesPrimarily adapted for aerobic/anaerobic respiration with limited acceptors
Proton motive forceGenerated through multiple pathways including CymA-dependent quinone cyclingMore limited pathways for PMF generation
Subunit adaptationsPossible specializations for function in cold/pressure environments (S. pealeana)Adapted for mesophilic conditions
Integration with metabolismClosely coupled with formate oxidation pathwaysLess dependent on formate metabolism

The ATP synthase in Shewanella species must integrate with their unique electron transport systems, particularly the CymA redox loop that contributes to proton motive force generation through quinone cycling and proton translocation across the inner membrane .

What expression systems yield optimal production of functional recombinant S. pealeana atpB?

For recombinant expression of S. pealeana atpB, several expression systems can be employed, with specific considerations:

Methodology for optimal expression:

  • Use low induction temperatures (16-20°C) to minimize inclusion body formation

  • Incorporate membrane-stabilizing additives such as glycerol (5-10%) in growth media

  • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Monitor expression using anti-His tag antibodies for C-terminal His-tagged constructs

Expression parameters should be optimized with small-scale trials before scaling up, as improper expression can lead to protein misfolding or aberrant channel activity that may compromise cell viability .

What purification strategies yield the highest purity and activity of recombinant atpB protein?

Purification of recombinant S. pealeana atpB presents challenges due to its hydrophobic nature as a membrane protein. A multi-step purification protocol is recommended:

  • Membrane isolation and solubilization:

    • Disrupt cells using French press or sonication in buffer containing protease inhibitors

    • Isolate membranes through differential centrifugation (typically 100,000×g for 1 hour)

    • Solubilize using mild detergents (DDM, LMNG, or C12E8 at 1-2%)

  • Affinity chromatography:

    • IMAC using Ni-NTA for His-tagged constructs, with low imidazole concentrations (10-20 mM) in wash buffers

    • Critical: maintain detergent concentration above CMC in all buffers

  • Size exclusion chromatography:

    • Separate monomeric protein from aggregates and remove remaining contaminants

    • Buffer should contain reduced detergent concentration (typically 2-3× CMC)

Purity assessment criteria:

  • SDS-PAGE should show >95% purity with minimal degradation products

  • Western blot confirmation using anti-His and anti-atpB antibodies

  • Mass spectrometry verification of intact protein

Functional validation can be performed using reconstitution into liposomes followed by proton translocation assays using pH-sensitive fluorescent dyes like ACMA .

How can researchers assay the functional activity of recombinant S. pealeana atpB in vitro?

Several complementary approaches can be used to assess the functional activity of recombinant S. pealeana atpB:

  • Proton translocation assays:

    • Reconstitute purified protein into liposomes

    • Use the ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching assay to monitor proton pumping activity

    • Procedure: Add ATP to proteoliposomes containing reconstituted ATP synthase in the presence of ACMA; fluorescence quenching indicates H⁺ translocation

    • Control experiments should include valinomycin/K⁺ to dissipate membrane potential

  • Electrophysiological characterization:

    • Patch-clamp recordings of submitochondrial vesicles (SMVs) or reconstituted proteoliposomes

    • Can detect both normal proton channel activity and leak conductance

    • Important for differentiating between proton-specific transport and non-specific leaks

  • ATP synthesis/hydrolysis coupled assays:

    • Measure ATP synthesis using luciferin/luciferase assays when protein is incorporated into an energized membrane

    • For ATP hydrolysis, use coupled enzyme assays (pyruvate kinase/lactate dehydrogenase) to monitor ADP production

The interpretation of functional data should account for the potential presence of uncoupled or leaky channels, which has been observed with ATP synthase subunits in various systems .

What biophysical techniques are most informative for structural characterization of S. pealeana atpB?

The structural characterization of S. pealeana atpB requires multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy:

    • Provides secondary structure composition (α-helical content expected to predominate)

    • Enables thermal stability assessment through temperature ramping

    • Sample requirements: 0.1-0.5 mg/ml protein in low-detergent, low-salt buffer

  • Cryo-Electron Microscopy:

    • Most powerful technique for high-resolution structure determination

    • Can visualize the protein in native-like lipid environments using nanodiscs

    • Enables visualization of atpB in context with other ATP synthase subunits

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps solvent-accessible regions and protein dynamics

    • Identifies regions involved in protein-protein interactions

    • Particularly valuable for membrane proteins where crystallization is challenging

  • Cross-linking Mass Spectrometry:

    • Determines spatial relationships between atpB and other ATP synthase subunits

    • Methodology: Use MS-cleavable crosslinkers followed by LC-MS/MS analysis

These approaches collectively provide insights into both structure and dynamics of the protein, which are essential for understanding its role in the ATP synthase complex and potential contributions to proton leak channels .

How does the atpB subunit contribute to proton gradient formation and energy coupling in S. pealeana?

The atpB subunit in S. pealeana plays a critical dual role in ATP synthase function:

  • Proton channel formation:

    • Forms a half-channel structure in conjunction with the c-ring

    • Contains conserved arginine residue that serves as the "gate" for proton movement

    • Facilitates unidirectional proton movement essential for maintaining PMF

  • Energy coupling mechanism:

    • Serves as the stationary component against which the c-ring rotates

    • Interacts with c-subunits through a network of charged and polar residues

    • Ensures efficient conversion of proton gradient energy to mechanical rotation

In Shewanella species, this energy coupling system is particularly important due to their respiratory versatility. Under anaerobic conditions, where electron acceptors with varying redox potentials are utilized, the efficiency of ATP synthase coupling directly impacts growth rates and yields .

Research has demonstrated that even minor alterations in the proton pathway can lead to proton leak, as observed in studies of ATP synthase c-subunit channels . This suggests that atpB's structure is carefully optimized to prevent such leaks while maintaining efficient proton translocation. The presence of uncoupled or leaky ATP synthase, as observed in some disease models, results in decreased ATP production efficiency and metabolic dysregulation .

What is the relationship between ATP synthase assembly and function in S. pealeana compared to other bacterial species?

ATP synthase assembly in bacteria involves a coordinated process to ensure proper incorporation of all subunits. For S. pealeana:

  • Assembly pathway comparison:

Assembly FeatureS. pealeana (predicted)Model Bacteria (E. coli)
F₁ assemblyLikely occurs independently in cytoplasmOccurs independently in cytoplasm
F₀ assemblyMembrane-associatedMembrane-associated
Integration timingLikely concurrent with translationFollowing independent assembly
Chaperone requirementsUnknown, likely species-specificRequires multiple dedicated chaperones
Transport mechanismUnknown for S. pealeanaNot applicable (assembled in situ)
  • Functional implications of assembly errors:

Improper assembly of ATP synthase can have significant consequences, as demonstrated in studies of other systems. When the ratio of subunits is imbalanced, as observed with free c-subunits in disease models, proton leak channels can form that compromise membrane integrity and energy conservation . Such leaks might explain why free c-subunit levels are typically tightly controlled in healthy cells.

Research in other bacterial species suggests that the assembly process involves intermediate complexes with quality control checkpoints. Identifying these intermediates in S. pealeana would provide valuable insights into any unique adaptations this organism may have evolved for its environmental niche.

  • Assembly dynamics under stress conditions:

S. pealeana, isolated from the nidamental gland of the squid Pealea sp., may have evolved unique assembly mechanisms adapted to its symbiotic lifestyle. Investigating how assembly dynamics change under various stress conditions (temperature, pH, salt) could reveal adaptations specific to this organism's ecological niche.

What are common challenges in expressing recombinant S. pealeana atpB and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant S. pealeana atpB:

  • Toxicity to host cells:

    • Challenge: Expression may create proton leaks in host cell membranes

    • Solution: Use tightly controlled inducible systems; consider C41/C43(DE3) E. coli strains designed for toxic membrane proteins; employ lower induction temperatures (16-18°C)

  • Inclusion body formation:

    • Challenge: Hydrophobic membrane proteins often aggregate

    • Solution: Use fusion partners (MBP, SUMO, Mistic); optimize expression temperature and inducer concentration; consider co-expression with chaperones (GroEL/ES)

  • Low yield after purification:

    • Challenge: Significant loss during extraction and purification steps

    • Solution: Optimize detergent type and concentration; use mild solubilization conditions; consider fluorescence-based optimization using GFP fusion constructs to rapidly identify best conditions

  • Non-functional protein:

    • Challenge: Protein lacks activity despite successful purification

    • Solution: Verify proper folding using CD spectroscopy; assess proton channel activity using ACMA assays; consider native nanodiscs instead of detergent micelles for maintaining function

Experimental data from various expression trials can help identify optimal conditions:

Expression ParameterRange TestedOptimal ConditionYield (mg/L culture)Activity (%)
Induction temperature15-37°C18°C0.8-1.285-90
IPTG concentration0.1-1.0 mM0.2 mM0.7-1.080-85
Expression time4-24 h16 h0.9-1.380-90
Detergent for extractionDDM, LMNG, C12E8DDM (1%)0.5-0.875-80

Note: These values are representative based on similar membrane proteins and would need to be validated specifically for S. pealeana atpB.

How can researchers address contradictory functional data from different assay systems?

Contradictory functional data is a common challenge when studying complex membrane proteins like ATP synthase subunits. Researchers should implement the following systematic approach:

  • Assay-specific artifacts identification:

    • Different detergents can affect protein function differently

    • Reconstitution efficiency varies between liposome preparations

    • Buffer components may influence results (especially ions like Mg²⁺, Ca²⁺)

  • Integrated analysis framework:

    • Cross-validate results using at least three independent functional assays

    • Perform negative controls with known inhibitors (oligomycin, DCCD)

    • Implement positive controls with well-characterized ATP synthase variants

  • Systematic troubleshooting protocol:

    • Prepare side-by-side comparisons under identical conditions

    • Create a decision tree based on possible failure points in each assay

    • Test temperature and pH dependence to identify optimal conditions

  • Resolution strategies for specific contradictions:

If proton pumping assays indicate function but ATP synthesis assays do not:

  • Verify membrane potential generation in reconstituted systems

  • Check for uncoupling between proton transport and ATP synthesis

  • Consider partial assembly problems in the recombinant system

Research has shown that the ATP synthase complex may form leak channels under certain conditions , which could complicate functional assessments. The presence of such leaks in recombinant systems should be systematically evaluated, as they may represent either artifacts of the expression system or genuine alternative functions of the protein.

How might the study of S. pealeana atpB contribute to understanding ATP synthase evolution in extremophiles?

Shewanella pealeana was isolated from the nidamental gland of the squid Pealea sp., representing a unique ecological niche. Studying its ATP synthase can provide valuable insights into evolutionary adaptations:

  • Comparative evolutionary analysis:

    • S. pealeana atpB sequence and structure should be compared with extremophiles adapted to different conditions (psychrophiles, piezophiles, halophiles)

    • Key residues in the proton channel region can be examined for signatures of adaptive evolution

    • The c-ring stoichiometry, which affects the bioenergetic efficiency, may show adaptations specific to S. pealeana's environment

  • Structure-function relationships across diverse environments:

    • Molecular dynamics simulations can reveal how atpB structure maintains function under different conditions

    • Chimeric proteins combining domains from different species can help identify key adaptive regions

    • Site-directed mutagenesis of conserved versus variable residues can test hypotheses about environmental adaptations

  • Implications for ATP synthase engineering:

    • Understanding natural adaptations in S. pealeana atpB could inform design of synthetic ATP synthases with enhanced stability or specific functional properties

    • Features that prevent proton leak while maintaining efficient ATP synthesis would be particularly valuable to identify

The study of S. pealeana atpB may reveal how ATP synthases maintain efficient energy coupling in specialized environmental niches, potentially uncovering novel mechanisms that could be applied in synthetic biology and biotechnology applications.

What role might atpB play in S. pealeana's adaptation to its symbiotic lifestyle?

As a symbiont isolated from squid nidamental glands, S. pealeana likely faces unique energetic challenges that may be reflected in its ATP synthase adaptations:

  • Host-microbe energy exchange:

    • The atpB subunit may show adaptations for functioning under the specific ionic conditions of the host environment

    • ATP synthesis efficiency might be optimized for the carbon sources available within the host

    • Potential regulatory mechanisms might coordinate ATP production with host physiological states

  • Metabolic integration with host systems:

    • Similar to findings in S. oneidensis, formate metabolism may contribute to proton motive force generation

    • The ability to rapidly switch between respiratory modes may be crucial for adapting to changing host conditions

    • ATP synthase regulation might be integrated with specific metabolic pathways important in the symbiotic relationship

  • Research approaches to explore symbiotic adaptations:

    • Comparative genomics between free-living and symbiotic Shewanella species focused on ATP synthase genes

    • Experimental evolution studies under conditions mimicking the host environment

    • Co-culture systems to evaluate ATP synthase function and regulation in the context of host-derived factors

Understanding these adaptations could provide broader insights into how bacteria optimize energy production during symbiotic relationships and the specific role of ATP synthase in maintaining these relationships.

How can recombinant S. pealeana atpB be utilized in bioenergetic research?

Recombinant S. pealeana atpB offers several valuable applications for advancing bioenergetic research:

  • Model system for proton translocation studies:

    • The purified protein can serve as a defined system for studying proton channel mechanics

    • Site-directed mutagenesis can identify critical residues involved in proton selectivity and gating

    • Comparison with other bacterial species can reveal evolutionary conservation of key functional elements

  • Biosensor development:

    • atpB-based sensors could detect changes in membrane potential or pH gradients

    • Conformational changes in atpB might be engineered to produce detectable signals in response to PMF

    • Such sensors would be valuable for studying bioenergetics in complex systems

  • Nanoscale energy transduction systems:

    • Reconstituted atpB in synthetic membranes could form the basis for artificial energy-harvesting devices

    • Integration with light-driven proton pumps could create self-contained energy conversion systems

    • Understanding how to prevent proton leak while maintaining transport efficiency would be critical for such applications

The detailed methodological approaches for these applications would include:

  • Protein engineering using rational design based on structural models

  • Directed evolution to optimize specific functions

  • Advanced imaging techniques to monitor protein dynamics during function

What insights can S. pealeana atpB structure provide for understanding mitochondrial ATP synthase disorders?

Despite evolutionary distance, bacterial ATP synthases share core structural and functional elements with mitochondrial counterparts, making S. pealeana atpB a valuable model system:

  • Conserved mechanisms in proton translocation:

    • The fundamental mechanism of proton transport through the a-subunit/c-ring interface is conserved

    • Bacterial models can help interpret disease-associated mutations in human ATP synthase

    • Specific residues involved in proton transfer pathways identified in S. pealeana can inform structure-function analysis of mitochondrial disorders

  • Leak pathway characterization:

    • Studies have shown that improper assembly or damage can convert ATP synthase into a leak channel

    • S. pealeana atpB could serve as a simplified system to study the structural transitions between functional channel and pathological leak

    • Understanding these transitions is relevant to mitochondrial disorders characterized by energy deficiency

  • Therapeutic strategy development:

    • Compounds that modulate bacterial ATP synthase activity (like Dexpramipexole ) might provide templates for developing treatments for mitochondrial disorders

    • High-throughput screening assays using recombinant S. pealeana atpB could identify novel modulators of proton channel function

    • The simplified bacterial system facilitates structure-activity relationship studies that would be challenging in mitochondrial systems

The bacterial model provides significant advantages for experimental manipulation while still offering insights into fundamental mechanisms relevant to human disease.

What emerging techniques might advance the study of S. pealeana atpB structure and function?

Several cutting-edge methodologies show promise for advancing our understanding of S. pealeana atpB:

  • Time-resolved cryo-EM:

    • Can capture different conformational states during the catalytic cycle

    • Would reveal dynamic structural changes during proton translocation

    • Technical approach: Use microfluidic mixing devices to initiate reactions before rapid freezing

  • Single-molecule FRET imaging:

    • Enables real-time monitoring of conformational changes in individual molecules

    • Could reveal heterogeneity in behavior not detectable in ensemble measurements

    • Requires strategic placement of fluorophores at key positions in the protein structure

  • In-cell structural biology:

    • Techniques like DEER/EPR spectroscopy can measure distances between specific residues in near-native environments

    • Could reveal how cellular environment influences atpB structure and dynamics

    • Complements high-resolution structural techniques with physiologically relevant conditions

  • Integrative spatial proteomics:

    • Recent advances allow tracking of protein movement within cells

    • Could reveal how S. pealeana ATP synthase complexes are distributed and transported

    • Methodology combines advanced imaging with mass spectrometry-based proteomics

These emerging technologies will help bridge the gap between static structural information and dynamic functional understanding, particularly for complex aspects like assembly pathways and subunit interactions.

How might synthetic biology approaches utilize engineered S. pealeana atpB variants?

Synthetic biology offers exciting possibilities for utilizing engineered S. pealeana atpB:

  • Designer ATP synthases with altered bioenergetics:

    • Engineering the c-ring/a-subunit interface could alter the H⁺/ATP ratio

    • Creating variants with enhanced stability under extreme conditions

    • Potential applications in biofuel cells and artificial photosynthesis systems

  • Controllable proton channels:

    • Incorporating light-sensitive or ligand-responsive domains

    • Creating switchable systems for controlled energy dissipation

    • Potential biomedical applications in controlling cellular metabolism

  • Minimal ATP synthase design:

    • Determining the essential components required for function

    • Engineering simplified versions for specific biotechnological applications

    • Understanding the minimal requirements for proton-driven ATP synthesis

  • Biosensor platform development:

    • Engineering atpB variants sensitive to specific environmental conditions

    • Creating reporter systems based on conformational changes

    • Applications in environmental monitoring and diagnostics

These approaches require precise protein engineering guided by detailed structural understanding, highlighting the importance of foundational research on native S. pealeana atpB structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.