Recombinant Shewanella pealeana Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Recombinant RnfE is derived from Shewanella pealeana (strain ATCC 700345/ANG-SQ1) and encoded by the rnfE gene (UniProt ID: A8H541). Key features include:

PropertyDescription
Gene LocusSpea_2358
Amino Acid Sequence231 residues (positions 1–231)
Expression SystemCell-free or E. coli systems, with tags determined during production
StorageTris-based buffer with 50% glycerol; stable at -20°C to -80°C
Purity≥85% (verified by SDS-PAGE)
FunctionElectron transport subunit of the Rnf complex, linked to Na+/H+ translocation

The full-length protein contains conserved transmembrane domains and residues critical for ferredoxin-mediated electron transfer .

Functional Role in Microbial Electron Transport

The Rnf complex in Shewanella species couples electron flow between reduced ferredoxin and NAD+/NADH, facilitating energy conservation via ion gradients. Key findings:

  • Mechanism: RnfE works alongside subunits RnfA-G to form a Na+- or H+-translocating module, enabling ATP synthesis under anaerobic conditions .

  • Physiological Context: In Shewanella pealeana, Rnf supports respiration of diverse electron acceptors (e.g., sulfur compounds, metals) by maintaining redox balance .

  • Biotechnological Relevance: Recombinant RnfE enables in vitro studies of electron transport chain energetics and enzyme interactions .

Evolutionary and Genomic Insights

The rnf operon is conserved in Shewanella species, with horizontal gene transfer (HGT) likely contributing to its dissemination across marine and sedimentary bacteria . Comparative genomics reveals:

  • Genetic Linkage: rnfE co-occurs with pfa (polyunsaturated fatty acid synthase) and ole (hydrocarbon biosynthesis) operons in S. pealeana, suggesting metabolic coordination between energy metabolism and lipid synthesis .

  • Regulation: Expression of rnfE is temperature-dependent, with elevated production at lower temperatures to optimize membrane bioenergetics .

Comparative Analysis with Related Proteins

FeatureRnfE (S. pealeana)RnfA (S. pealeana)CymA (S. oneidensis)
GenernfErnfAcymA
FunctionElectron transportComplex assemblyPeriplasmic cytochrome
LocalizationMembraneMembranePeriplasm
Role in RespirationNa+/H+ translocationStructural stabilityElectron shuttle

Future Research Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve RnfE’s role in ion channeling .

  • Metabolic Engineering: Leveraging recombinant RnfE to enhance microbial electrosynthesis or bioremediation .

  • Interactome Mapping: Identifying binding partners in Shewanella’s electron transport network .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnfE; Spea_2358; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Target Names
Spea_2358
Target Protein Sequence
MSDYKELTKQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATMLVLIGSNILVSLVR DFVPKEIRIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFAS RNSVAKSAFDGLMMGLGFTLVLSVLGAAREILGQGTLFYGADQLLGEWAKSLTIHIWQVN TSFLLAMLPPGAFIGMGLLIALKNAIDQYLATKQPKVEQEAPTRARITKVN
Uniprot No.

Target Background

Function
A component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella pealeana and why is its RnfE protein significant?

Shewanella pealeana is a marine bacterial species belonging to the genus Shewanella, which is known for its remarkable respiratory versatility. S. pealeana was originally isolated as a symbiont or epibiont in marine environments . The significance of its RnfE protein lies in its role within the electron transport complex, which enables the bacterium to utilize various electron acceptors during respiration. The RnfE protein is part of the Rnf complex (Rhodobacter nitrogen fixation), a membrane-bound electron transport system that facilitates electron transfer between NADH and ferredoxin.

Unlike simpler protein characterization approaches, understanding RnfE involves examining its physiological context within S. pealeana's metabolic adaptations to marine environments. For comprehensive investigations, researchers should analyze the protein in relation to the complete electron transport chain rather than as an isolated component.

What is the structure and function of the Electron transport complex protein RnfE in Shewanella pealeana?

The Electron transport complex protein RnfE in Shewanella pealeana is a membrane-bound protein with 231 amino acids . Based on the amino acid sequence, RnfE appears to be a hydrophobic protein with multiple transmembrane domains, which is consistent with its role in the electron transport chain.

The RnfE protein sequence (MSDYKELTKQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATmLVLIGSNILVSLVRDFVPKEIRIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFASRNSVAKSAFDGLMMGLGFTLVLSVLGAAREILGQGTLFYGADQLLGEWAKSLTIHIWQVNTSFLLAmLPPGAFIGMGLLIALKNAIDQYLATKQPKVEQEAPTRARITKVN) shows characteristics typical of transmembrane proteins involved in electron transport .

Functionally, the RnfE protein is part of the Rnf complex that couples the oxidation of reduced ferredoxin to the reduction of NAD+, thereby contributing to energy conservation in the form of an ion gradient across the membrane. This process is essential for the bacterium's ability to adapt to various environmental conditions and utilize different electron acceptors for respiration.

How does the RnfE protein relate to Shewanella's metal-reducing capabilities?

Shewanella species are well-known for their ability to reduce various metals in anaerobic environments . The RnfE protein, as part of the electron transport chain, indirectly contributes to these metal-reducing capabilities by participating in the electron flow that ultimately leads to metal reduction.

Research methodologies investigating this relationship should include comparative genomics of RnfE across Shewanella species with varying metal reduction capabilities, coupled with gene knockout studies to assess the impact of RnfE absence on metal reduction rates.

How does the RnfE complex in S. pealeana compare to similar complexes in other Shewanella species?

The RnfE complex in S. pealeana shows both conservation and divergence when compared to similar complexes in other Shewanella species. Comparative genomic analysis of the genus Shewanella reveals that electron transport proteins, including RnfE, have undergone adaptive evolution to optimize for specific environmental niches .

For example, while the core function of electron transport remains conserved, species like S. oneidensis MR-1 (freshwater) and S. pealeana (marine) show variations in their electron transport proteins that likely reflect adaptations to their respective environments . These adaptations may include differences in substrate specificity, regulation, and interaction with other components of the electron transport chain.

A comprehensive phylogenetic analysis of RnfE proteins across the Shewanella genus would reveal evolutionary patterns and potential functional specializations. Researchers investigating these variations should employ methods that combine sequence analysis, structural predictions, and experimental validation of function.

What role does RnfE play in the biogeochemical cycling of metals in marine environments?

RnfE contributes to biogeochemical metal cycling in marine environments through its role in Shewanella's respiratory versatility. The Rnf complex facilitates electron transfer processes that ultimately enable Shewanella to reduce or oxidize metals such as iron and manganese .

Studies have shown that Shewanella species are abundant in environments with high metal concentrations, such as the estuarine turbidity maxima of the Columbia River, where they participate in manganese cycling . In these environments, Shewanella can both oxidize Mn(II) to Mn(III/IV) under aerobic conditions and reduce manganese oxides under anaerobic conditions .

Research into RnfE's specific role should combine environmental metatranscriptomics to assess gene expression in natural settings with laboratory experiments using defined media with various metal concentrations. This approach would provide insights into how environmental factors regulate RnfE expression and function in relation to metal cycling.

How has horizontal gene transfer influenced the evolution of the RnfE gene in Shewanella pealeana?

Horizontal gene transfer (HGT) has likely played a significant role in shaping the evolution of the RnfE gene in Shewanella pealeana. Shewanella species are known to acquire a wide variety of mobile genetic elements, including plasmids, prophages, group II introns, integrons, and integrative and conjugative elements .

Comparative genomic analysis suggests that multiple HGT events have contributed to the diversification of Shewanella species and their adaptation to specific niches . These events may have influenced the acquisition, loss, or modification of genes involved in electron transport, including RnfE.

To investigate the evolutionary history of RnfE, researchers should:

  • Conduct phylogenetic analyses comparing RnfE sequences across diverse bacterial taxa

  • Examine the genomic context of RnfE for signatures of HGT, such as unusual GC content or codon usage patterns

  • Identify potential mobile genetic elements that may have facilitated the transfer of RnfE or its modifications

What are the optimal conditions for expressing recombinant Shewanella pealeana RnfE protein?

The optimal conditions for expressing recombinant S. pealeana RnfE protein require careful consideration of the protein's membrane-bound nature. Based on research with similar proteins, the following expression system is recommended:

  • Expression system: E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3)

  • Vector selection: pET vectors with a signal sequence to facilitate membrane insertion

  • Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM)

  • Media supplements: Addition of specific lipids that mimic the native membrane environment

A systematic optimization approach should test multiple conditions as outlined in the table below:

ParameterVariables to TestMeasurement Method
Temperature16°C, 20°C, 25°C, 30°CSDS-PAGE, Western blot
IPTG Concentration0.1 mM, 0.5 mM, 1.0 mMSDS-PAGE, Western blot
Induction Time4h, 8h, 16h, 24hSDS-PAGE, Western blot
Media CompositionLB, TB, 2xYT, MinimalYield quantification

For purification, detergent screening is essential to identify conditions that maintain the protein's native conformation while solubilizing it from the membrane.

What techniques are most effective for studying the electron transport function of RnfE in vitro?

Studying the electron transport function of RnfE in vitro requires specialized techniques that can measure electron transfer activities. The most effective methods include:

  • Electrochemical techniques: Cyclic voltammetry and differential pulse voltammetry can probe the redox properties of the purified RnfE protein when immobilized on electrode surfaces .

  • Spectroscopic methods: UV-visible spectroscopy and electron paramagnetic resonance (EPR) spectroscopy can track changes in redox states of the protein.

  • Reconstitution in liposomes: Incorporating purified RnfE into liposomes allows for measurement of ion gradients generated by electron transport activity.

  • Isothermal titration calorimetry (ITC): This technique can determine binding affinities between RnfE and electron donors/acceptors.

  • Stopped-flow kinetics: For measuring rapid electron transfer rates between RnfE and its redox partners.

When implementing these techniques, researchers should control for potential artifacts by including appropriate negative controls and validating results using multiple complementary approaches.

How can genetic manipulation techniques be applied to study RnfE function in Shewanella pealeana?

Genetic manipulation of Shewanella pealeana to study RnfE function requires consideration of the bacterium's unique characteristics. The following methodological approaches are recommended:

  • Gene deletion/knockout: CRISPR-Cas9 or traditional homologous recombination methods can be used to create rnfE knockout strains. Phenotypic analysis should focus on growth rates under various electron acceptor conditions, metal reduction capabilities, and metabolic profiling.

  • Complementation studies: Reintroducing wild-type or mutated versions of rnfE into knockout strains can confirm phenotypes and investigate specific domains.

  • Reporter gene fusions: Fusing reporter genes like gfp or lacZ to the rnfE promoter can help study regulation under different environmental conditions.

  • Site-directed mutagenesis: Targeted mutations of conserved residues can identify critical amino acids for protein function.

  • Inducible expression systems: Developing a controlled expression system allows titration of RnfE levels to observe dosage effects.

For reference organisms, both S. oneidensis MR-1 and E. coli can serve as comparative systems, with the caveat that functional differences may exist due to evolutionary adaptation to different environments .

How should researchers interpret variations in RnfE activity across different experimental conditions?

When interpreting variations in RnfE activity across different experimental conditions, researchers should consider multiple factors that influence electron transport complexes:

  • Redox environment: Changes in oxygen availability, redox potential, and presence of alternative electron acceptors can significantly impact RnfE activity. Interpret data in the context of Shewanella's respiratory versatility, which allows it to utilize various electron acceptors depending on environmental conditions .

  • Metal availability: Since Shewanella species are known for their metal-reducing capabilities, variations in RnfE activity may correlate with the availability and type of metals in the experimental setup .

  • Membrane composition: As a membrane-bound protein, RnfE function is influenced by membrane fluidity and composition. Temperature-dependent changes in activity may reflect alterations in membrane properties rather than direct effects on the protein itself.

  • Regulatory mechanisms: Consider post-translational modifications or interaction with regulatory proteins that might modulate RnfE activity under different conditions.

  • Experimental artifacts: Control for potential artifacts by establishing baseline measurements and including appropriate controls in each experiment.

A systematic approach to data analysis should include multivariate statistical methods to identify correlations between experimental conditions and observed activities.

What are the key considerations when comparing RnfE function between laboratory cultures and environmental samples?

When comparing RnfE function between laboratory cultures and environmental samples, researchers must account for several key factors:

  • Genetic diversity: Environmental Shewanella populations exhibit greater genetic diversity than laboratory strains. Metagenomics approaches may reveal multiple RnfE variants with potentially different functional properties .

  • Ecological context: In environmental settings, Shewanella operates within complex microbial communities where interspecies interactions may influence RnfE expression and function. Laboratory cultures lack this ecological complexity.

  • Adaptation to laboratory conditions: Laboratory strains may have adapted to cultivation conditions, potentially altering their gene expression patterns relative to their environmental counterparts.

  • Technical limitations: Methods for measuring RnfE function in environmental samples may have different sensitivities and specificities compared to laboratory techniques.

  • Environmental variables: Factors such as temperature, pH, salinity, and redox conditions differ between laboratory and environmental settings and should be accounted for in comparisons.

To address these considerations, researchers should develop standardized protocols that minimize methodological biases and include environmental parameter measurements alongside functional assays.

What are common challenges in purifying active RnfE protein and how can they be overcome?

Purifying active RnfE protein presents several challenges due to its membrane-bound nature. Common issues and their solutions include:

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use specialized expression strains (C41/C43), and consider fusion tags that enhance expression without compromising function.

  • Protein misfolding and aggregation:

    • Challenge: Improper folding leads to inclusion body formation.

    • Solution: Lower expression temperature (16-20°C), use mild induction conditions, and consider chaperone co-expression systems.

  • Detergent-induced inactivation:

    • Challenge: Detergents necessary for solubilization may disrupt protein structure and function.

    • Solution: Screen multiple detergents at various concentrations, preferably using small-scale activity assays to identify conditions that maintain function.

  • Loss of essential cofactors:

    • Challenge: Purification may strip away cofactors essential for activity.

    • Solution: Supplement purification buffers with potential cofactors and consider reconstitution steps.

  • Oxidative damage:

    • Challenge: Exposure to oxygen may damage redox-sensitive residues.

    • Solution: Perform purification under anaerobic conditions or include reducing agents in buffers.

A systematic troubleshooting approach should include quality control checkpoints at each purification stage, with activity assays to ensure the protein remains functional.

How can researchers address data reproducibility issues when working with RnfE from Shewanella pealeana?

Addressing data reproducibility issues when working with RnfE requires rigorous attention to experimental details and standardization:

  • Standardized protein preparation:

    • Document all parameters including growth conditions, induction timing, purification methods, and storage conditions.

    • Establish quality control criteria (purity, concentration, activity) that samples must meet before experiments.

  • Detailed metadata capture:

    • Record comprehensive metadata for all experiments, including batch information, reagent sources, and environmental conditions.

    • Use electronic lab notebooks with structured data fields to ensure consistent documentation.

  • Biological variability assessment:

    • Distinguish between technical and biological replicates.

    • Use multiple independent protein preparations to account for batch-to-batch variations.

  • Method standardization:

    • Develop standard operating procedures (SOPs) for key assays.

    • Include internal controls and calibration standards in each experiment.

  • Data sharing practices:

    • Share raw data alongside processed results.

    • Provide detailed methods sections that enable others to reproduce the work.

Researchers should also consider interlaboratory validation studies for critical findings and utilize statistical approaches that account for various sources of variability.

What are promising research directions for understanding RnfE's role in bacterial adaptation to environmental changes?

Several promising research directions can enhance our understanding of RnfE's role in bacterial adaptation:

How might understanding RnfE function contribute to biotechnological applications involving Shewanella species?

Understanding RnfE function could enable several biotechnological applications:

  • Bioelectrochemical systems: Optimizing electron transfer processes in microbial fuel cells by engineering RnfE could enhance power generation. Shewanella's ability to transfer electrons to external acceptors makes it valuable for bioelectrochemical applications .

  • Bioremediation enhancement: Engineering Shewanella strains with modified RnfE proteins could improve their metal reduction capabilities for remediation of metal-contaminated environments. Studies have shown that Shewanella species are effective in reducing toxic metals to less harmful forms .

  • Biosensor development: RnfE-based biosensors could detect specific environmental conditions or contaminants based on electron transfer activity changes.

  • Synthetic biology platforms: Incorporating RnfE into designer electron transport chains could create microorganisms with novel metabolic capabilities for bioproduction of chemicals.

  • Antimicrobial resistance mitigation: Understanding how RnfE contributes to Shewanella's role as a reservoir of antimicrobial resistance genes could help develop strategies to prevent resistance transfer to pathogens .

Research in these directions should consider both the fundamental biochemical properties of RnfE and its integration into cellular metabolism across different environmental conditions.

What interdisciplinary approaches could advance our understanding of RnfE in the context of marine ecosystem function?

Advancing our understanding of RnfE in marine ecosystems requires interdisciplinary approaches that bridge multiple fields:

  • Integrated omics with oceanography: Combining metagenomics, metatranscriptomics, and metaproteomics with physical and chemical oceanographic measurements would contextualize RnfE function within marine biogeochemical cycles. This approach could identify how water column stratification, seasonal changes, and ocean currents influence Shewanella populations and their RnfE expression.

  • Biogeochemistry and molecular biology fusion: Pairing isotope labeling studies with molecular techniques would track how RnfE-mediated electron transfer impacts element cycling in marine sediments. This would quantify the contribution of Shewanella to manganese and iron cycling in coastal environments .

  • Ecological network analysis: Investigating how Shewanella interactions with other marine microorganisms affect RnfE expression and function would reveal community-level impacts on electron transport processes.

  • Climate change biology perspectives: Examining how changing ocean conditions (temperature, pH, oxygen levels) influence RnfE function would provide insights into future ecosystem responses.

  • Biophysics approaches to environmental samples: Applying advanced microscopy and spectroscopy techniques to natural samples would visualize RnfE localization and activity in situ.

These interdisciplinary approaches would benefit from standardized sampling protocols and data integration frameworks to maximize comparative analyses across different marine ecosystems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.