Recombinant Shewanella pealeana Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Lipoprotein signal peptidase (lspA)

Lipoprotein signal peptidase (lspA), also known as prolipoprotein signal peptidase or signal peptidase II (SPase II), is a specialized enzyme that plays a crucial role in bacterial lipoprotein biosynthesis. This enzyme is responsible for the second step in the processing of bacterial lipoproteins, specifically catalyzing the removal of signal peptides from prolipoproteins following their modification with diacylglyceryl by prolipoprotein diacylglyceryl transferase. The enzyme is essential for proper bacterial membrane function and has gained significant attention in the scientific community due to its potential as an antibiotic target, as it is found exclusively in bacteria and has no human homologs. The recombinant form of this enzyme from Shewanella pealeana provides researchers with a valuable tool for studying bacterial membrane dynamics and protein processing pathways .

Lipoprotein signal peptidase functions as a membrane-embedded aspartic protease that specifically recognizes and cleaves the signal peptide from modified prolipoproteins. This cleavage occurs at a specific site, typically after a conserved sequence motif known as the lipobox. The enzyme's high substrate specificity ensures the precise processing of lipoproteins, which is essential for their proper localization and function within the bacterial cell. The recombinant form of S. pealeana lspA maintains this specificity while offering the advantages of controlled production and purification for research applications .

Shewanella pealeana: Source Organism

Shewanella pealeana is a mesophilic, facultatively anaerobic, psychrotolerant bacterium that was first isolated from a microbial community colonizing the accessory nidamental gland of the squid Loligo pealei. The type strain, designated as ANG-SQ1T, belongs to the γ-3 subclass of the Proteobacteria. Morphologically, S. pealeana cells are motile, Gram-negative rods measuring approximately 2.0–3.0 μm in length and 0.4–0.6 μm in width .

This bacterium demonstrates optimal growth within a temperature range of 25–30°C and a pH range of 6.5–7.5, particularly in media containing 0.5 M NaCl. It exhibits metabolic versatility, capable of utilizing various compounds as sole energy sources under aerobic conditions, including glucose, lactate, acetate, pyruvate, glutamate, citrate, succinate, Casamino acids, yeast extract, and peptone. Under anaerobic conditions, S. pealeana can grow by reducing various terminal electron acceptors such as iron, manganese, nitrate, fumarate, trimethylamine-N-oxide, thiosulfate, and elemental sulfur .

The genomic analysis of S. pealeana has revealed several genes involved in membrane protein processing, including the lspA gene (designated as Spea_1084), which encodes the lipoprotein signal peptidase. The bacterial genome adaptation to its unique squid gland habitat likely influences the specific properties of its membrane processing machinery, including the lspA protein .

Biochemical Properties

Lipoprotein signal peptidase from S. pealeana functions as an aspartic protease with the EC number 3.4.23.36. The enzyme specifically catalyzes the removal of signal peptides from bacterial membrane prolipoproteins after they have been modified with a diacylglyceryl group. This cleavage is a critical step in the maturation of bacterial lipoproteins and is essential for their proper localization and function .

The catalytic mechanism involves the hydrolysis of a specific peptide bond, typically at a sequence motif -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, where Xaa is often a hydrophobic amino acid (preferably leucine), and both Yaa (alanine or serine) and Zaa (glycine or alanine) have small, neutral side chains. The cleavage occurs immediately before the modified cysteine residue, releasing the signal peptide and exposing the lipid-modified N-terminal cysteine of the mature lipoprotein .

The enzyme demonstrates high substrate specificity, recognizing only prolipoproteins that have been previously modified with a diacylglyceryl group at the cysteine residue within the lipobox motif. This specificity ensures the precise processing of lipoproteins within the complex mixture of proteins present in bacterial membranes. The recombinant form of the enzyme maintains this specificity, making it valuable for research applications requiring the selective processing of lipoprotein precursors .

Production of Recombinant S. pealeana lspA

The recombinant Shewanella pealeana Lipoprotein signal peptidase is typically produced using bacterial expression systems, with Escherichia coli being the most common host. The production process involves cloning the lspA gene (Spea_1084) into suitable expression vectors, followed by transformation into the bacterial host. The expression is then induced under controlled conditions to maximize protein yield while maintaining functionality .

Due to the membrane-embedded nature of lspA, its expression and purification present significant challenges. Specialized approaches, such as the use of detergents or membrane-mimetic systems, are often required to extract and stabilize the protein. The recombinant protein may be engineered to include affinity tags, such as polyhistidine tags, to facilitate purification through affinity chromatography. The tag type for commercial recombinant lspA products is typically determined during the production process to optimize yield and functionality .

Quality control measures for recombinant S. pealeana lspA include assessments of purity, typically through SDS-PAGE analysis, and functional assays to confirm the enzymatic activity. The commercial preparations are often provided in specialized buffer systems that maintain protein stability and activity during storage and handling .

Applications and Research Significance

Recombinant Shewanella pealeana Lipoprotein signal peptidase has numerous applications in both basic research and biotechnological contexts. In basic research, it serves as a valuable tool for studying bacterial lipoprotein processing pathways and membrane protein dynamics. By providing a purified form of the enzyme, researchers can investigate the specificity and mechanism of lipoprotein signal peptide cleavage under controlled conditions .

One of the primary applications of recombinant S. pealeana lspA is in enzyme-linked immunosorbent assays (ELISA), where it can be used as a standard or capture antigen for detecting antibodies against bacterial lipoprotein processing enzymes. This application is particularly valuable in research focused on bacterial pathogenesis and host-pathogen interactions .

From a biotechnological perspective, recombinant lspA has potential applications in the production of modified bacterial lipoproteins for vaccine development and drug delivery systems. The enzyme's specific cleavage activity can be exploited to generate precisely processed lipoproteins with defined modifications, which may serve as components of subunit vaccines or carriers for drug delivery .

Additionally, as a bacterial-specific enzyme with no human homologs, lipoprotein signal peptidase represents a promising target for antibiotic development. Research using the recombinant enzyme can facilitate high-throughput screening of potential inhibitors, potentially leading to the development of novel antibiotics targeting bacterial lipoprotein processing .

Comparison with lspA from Other Species

The lipoprotein signal peptidase from Shewanella pealeana shares significant sequence and functional similarities with lspA proteins from other bacterial species. For instance, comparison with the lspA from Shewanella amazonensis reveals considerable homology, reflective of their shared evolutionary history and conserved functional roles .

Despite these similarities, species-specific variations in lspA proteins can influence their substrate preferences, catalytic efficiencies, and responses to inhibitors. These differences may arise from adaptations to the specific membrane compositions and environmental niches of their respective bacterial hosts. For S. pealeana, which was isolated from a squid accessory nidamental gland, the lspA protein may have specific adaptations related to this unique ecological context .

Table 3: Comparison of lspA Characteristics Across Shewanella Species

FeatureS. pealeana lspAS. amazonensis lspA
Amino Acid Length170 residues168 residues
Gene LocusSpea_1084Designated in genome
Host Organism EnvironmentSquid accessory nidamental glandFreshwater and marine environments
Sequence SimilarityReferenceHigh similarity to S. pealeana
Optimal Temperature RangeBased on organism: 25-30°CBased on organism: Variable

Comparative studies of lspA proteins across diverse bacterial species provide valuable insights into the evolution of lipoprotein processing mechanisms and may reveal species-specific features that could be exploited for the development of selective inhibitors. The recombinant forms of these enzymes, including S. pealeana lspA, facilitate such comparative analyses by providing purified proteins for detailed biochemical and structural investigations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requirements. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; Spea_1084; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Target Names
lspA
Target Protein Sequence
MPTNWKDSGLRWYWVVVLVFLADQLSKQWVLSNFDLYESIQLLPVFNFTYVRNYGAAFSF LSDAGGWQRWLFTFVAVGFSVLLSVWLRQQPSKMWRLNLAYTLVIGGALGNLIDRLQHGY VVDFLDFYWNTSHFPAFNIADSAICVGAGLIILDSFVAGKDDKKSDGIKE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (lspA) and what is its function in Shewanella pealeana?

Lipoprotein signal peptidase (lspA) in Shewanella pealeana functions as an aspartyl protease (EC 3.4.23.36) that cleaves the transmembrane helix signal peptide of lipoproteins during post-translational processing. This enzyme, also known as prolipoprotein signal peptidase or Signal peptidase II (SPase II), is integral to the bacterial lipoprotein-processing pathway . The cleavage occurs after the lipid modification of the conserved cysteine residue in the lipobox motif of the signal peptide. To study this function experimentally, researchers can utilize gel-shift assays where recombinant prepro inhibitor of cysteine protease (ppICP) is first converted by Lgt using dioleoylphosphatidylglycerol (DOPG) as the lipid substrate, followed by LspA-mediated cleavage which produces a measurable molecular weight shift detectable via SDS-PAGE . This processing is critical for proper lipoprotein maturation and localization within the bacterial cell envelope.

How is the Shewanella genus characterized, and where does S. pealeana fit taxonomically?

Shewanella are gram-negative motile bacilli predominantly found in soil and water environments, particularly in warm climates . The genus comprises numerous species, with S. algae and S. putrefaciens most commonly associated with human disease . Many Shewanella species are psychrotolerant or psychrophilic, demonstrating optimal growth at temperatures below 25°C . S. pealeana specifically belongs to this psychrophilic group, originally isolated from the nidamental gland of the squid Loligo pealei (strain ATCC 700345 / ANG-SQ1) . Within the Shewanellaceae family, S. pealeana is characterized by its distinct lipopolysaccharide (LPS) profile, which may be affected by growth temperature like other Shewanella species . For taxonomic classification studies, researchers should consider multiple molecular markers including 16S rRNA sequencing and whole-genome analyses, as well as phenotypic characteristics such as temperature-dependent growth profiles and LPS organization patterns.

How does the conformational dynamics of lspA influence its enzymatic function?

The conformational dynamics of lspA play a crucial role in its enzymatic function through a mechanism that involves significant flexibility of the periplasmic helix (PH). Based on molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) studies, the periplasmic helix of LspA fluctuates on the nanosecond timescale, sampling distinct conformations in different states . In the apo state, the dominant conformation is closed, occluding the charged active site from the lipid bilayer, which likely protects the catalytic residues when no substrate is present .

When transitioning to substrate binding, the protein must adopt a more open conformation to accommodate the lipoprotein substrate. This dynamic between open and closed states explains how LspA can process such a variety of substrates with different sequences . The conformational flexibility is particularly evident in the "clamp" mechanism proposed for substrate binding, where the β-cradle and periplasmic helix work together to position the substrate correctly for catalysis . Researchers investigating these dynamics should employ a combination of computational approaches (MD simulations) and experimental techniques (EPR spectroscopy, FRET) to characterize the equilibrium between different conformational states and correlate them with enzymatic activity.

What are the implications of lspA inhibition for bacterial viability and antibiotic development?

LspA inhibition presents significant implications for bacterial viability and represents a promising target for antibiotic development for several key reasons. First, LspA is essential for viability in Gram-negative bacteria and important for virulence in Gram-positive bacteria . Second, the catalytic dyad residues and 14 additional highly conserved residues surrounding the active site suggest that resistance mutations would likely interfere with the enzyme's natural function, making resistance development less probable .

Experimental evidence demonstrates that compounds like globomycin and myxovirescin can bind to LspA and stabilize intermediate conformations that prevent both signal peptide cleavage and substrate binding . The binding of these antibiotics reveals that LspA can adopt different conformations with different inhibitors while maintaining similar interactions with the catalytic dyad . For researchers developing new antibiotics targeting LspA, understanding these conformational changes is crucial. Experimental approaches should include structure-based drug design informed by the known binding modes of existing inhibitors, combined with functional assays such as the SDS-PAGE gel-shift assay to quantify inhibition of LspA activity . Virtual screening approaches followed by biochemical validation could identify novel chemical scaffolds with improved pharmacological properties compared to existing inhibitors.

How do temperature changes affect the lipopolysaccharide profile in Shewanella species, and what implications might this have for lspA function?

Temperature changes significantly impact the lipopolysaccharide (LPS) profiles in many Shewanella species, which may indirectly influence lspA function. Studies have shown that growth at temperatures below 25°C results in a transition from rough to semi-rough LPS in S. oneidensis MR-1, manifested as additional bands above the putative core in gel electrophoresis analyses . Maximum LPS heterogeneity is typically observed at 15-20°C, with S. frigidimarina exhibiting a characteristic ladder-like banding pattern at 15°C . This temperature sensitivity reflects the psychrotolerant or psychrophilic nature of many Shewanella organisms .

The temperature-dependent modulation of LPS could impact lspA function through several mechanisms. Since lspA operates within the bacterial membrane where LPS is a major component, changes in LPS organization may alter the local environment around the enzyme, potentially affecting its conformational dynamics and substrate accessibility. Furthermore, as lipoproteins processed by lspA often interact with LPS in the membrane, temperature-induced modifications to LPS might indirectly influence substrate presentation to lspA.

To investigate these relationships experimentally, researchers should consider:

  • Growth experiments at various temperatures (5-30°C) to characterize LPS profiles via SDS-PAGE with silver staining

  • Concurrent measurements of lspA activity across temperature ranges using gel-shift assays

  • Membrane fluidity analyses using fluorescence anisotropy to correlate with enzyme activity

  • Comparative proteomics to identify temperature-dependent changes in lipoprotein expression and processing

What are the optimal conditions for expressing and purifying recombinant S. pealeana lspA?

For optimal expression and purification of recombinant S. pealeana lspA, researchers should consider a systematic approach addressing the challenges of membrane protein production. Based on available information about similar proteins and commercial preparations , the following methodology is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or C43(DE3) strains (specialized for membrane proteins)

  • Vector containing the lspA gene (Spea_1084) with an appropriate tag (His6 or Strep-tag II)

  • Addition of a TEV protease cleavage site between the tag and protein if tag removal is desired

Culture Conditions:

  • LB or TB media supplemented with appropriate antibiotics

  • Induction at OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG

  • Post-induction growth at 18-20°C for 16-20 hours (leveraging the psychrophilic nature of the source organism)

Extraction and Purification:

  • Cell lysis via sonication or high-pressure homogenization in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

  • Membrane isolation by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilization with detergents (DDM, LMNG, or CHAPS at 1-2% w/v) for 2-3 hours at 4°C

  • Affinity chromatography using Ni-NTA or Strep-Tactin resin

  • Size exclusion chromatography for final purification

Storage Conditions:

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week

This protocol should yield functionally active protein suitable for structural and functional studies. Protein quality should be assessed via SDS-PAGE, Western blotting, and activity assays before proceeding to experimental applications.

How can researchers design effective assays to measure lspA activity and inhibition?

Designing effective assays to measure lspA activity and inhibition requires approaches that capture the enzyme's specific proteolytic function. Based on methodologies mentioned in the literature, the following assay designs are recommended:

SDS-PAGE Gel-Shift Assay:

  • Prepare recombinant substrate protein (e.g., prepro inhibitor of cysteine protease, ppICP) containing the appropriate signal peptide

  • Convert ppICP to pICP using Lgt enzyme and dioleoylphosphatidylglycerol (DOPG) as lipid substrate

  • Incubate pICP with purified lspA (with or without inhibitors)

  • Analyze via SDS-PAGE to detect the ~10 kDa molecular weight shift resulting from signal peptide cleavage

  • Quantify product (DA-ICP) band intensity to determine enzyme activity or inhibition

Fluorescence-Based Assay:

  • Develop a FRET-based substrate with fluorophore/quencher pairs flanking the cleavage site

  • Measure fluorescence increase upon cleavage in real-time

  • Calculate enzyme kinetics (Km, Vmax) and inhibition parameters (IC50, Ki)

Biophysical Interaction Assays:

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI) to measure binding kinetics of inhibitors

  • Thermal Shift Assays (TSA) to evaluate stabilization effects of inhibitors on protein structure

  • Isothermal Titration Calorimetry (ITC) to determine thermodynamic parameters of inhibitor binding

For inhibition studies, researchers should include controls such as known inhibitors (e.g., globomycin) and implement a systematic approach to characterize inhibition mechanisms (competitive, non-competitive, or uncompetitive). Data analysis should employ appropriate enzyme kinetics models and statistical methods to ensure reproducibility and reliability of results.

What molecular dynamics (MD) simulation and electron paramagnetic resonance (EPR) approaches can be used to study lspA conformational dynamics?

To effectively study lspA conformational dynamics, researchers can implement complementary MD simulation and EPR approaches as demonstrated in previous research on similar enzymes :

Molecular Dynamics Simulation Protocol:

  • System Preparation:

    • Embed the protein in a mixed lipid bilayer (e.g., POPG:POPE at 1:4 molar ratio)

    • Solvate system with explicit water and add counterions to neutralize

    • Use an appropriate force field (e.g., CHARMM36 for proteins and lipids)

  • Simulation Strategy:

    • Begin with coarse-grained simulations (e.g., Martini 2.2 force field) for membrane assembly and equilibration

    • Apply elastic network constraints between backbone atoms (1000 kJ mol⁻¹ nm⁻²) for initial stability

    • Convert to all-atom representation for production runs

    • Conduct equilibration followed by long production runs (>500 ns)

  • Analysis Techniques:

    • Root mean square deviation/fluctuation (RMSD/RMSF)

    • Principal component analysis to identify dominant modes

    • Hydrogen bond and salt bridge monitoring

    • Free energy calculations for conformational transitions

EPR Spectroscopy Approach:

  • Sample Preparation:

    • Site-directed spin labeling at strategic positions (particularly in the periplasmic helix)

    • Use cysteine-specific labels such as MTSL (1-oxyl-2,2,5,5-tetramethylpyrroline-3-methyl methanethiosulfonate)

    • Reconstitute labeled protein in nanodiscs or liposomes

  • Experimental Measurements:

    • Continuous wave EPR for mobility analysis

    • Double electron-electron resonance (DEER) for distance measurements between labeled sites

    • Temperature-dependent studies to explore dynamic transitions

  • Data Integration:

    • Cross-validate MD simulations with EPR distance constraints

    • Generate ensemble models representing the conformational landscape

    • Correlate conformational states with functional states (apo vs. inhibitor-bound)

The combination of these techniques provides unique insights into protein dynamics not observable in static crystal structures. Restraint-driven MD using EPR distance measurements can generate functionally relevant structural models for different states of the enzyme, particularly important for capturing the nanosecond timescale fluctuations of the periplasmic helix that may be crucial for substrate recognition and catalysis .

What role might S. pealeana lspA play in the organism's adaptation to its natural environment?

S. pealeana was originally isolated from the nidamental gland of the squid Loligo pealei, suggesting a potential symbiotic relationship . In this context, lspA likely plays critical roles in the bacterium's environmental adaptation through several mechanisms:

  • Temperature Adaptation: As a psychrophilic organism, S. pealeana must maintain membrane fluidity and protein function at lower temperatures. The conformational dynamics of lspA may be fine-tuned to operate optimally in the temperature range of its host environment. Like other Shewanella species, S. pealeana likely exhibits temperature-dependent modulation of its membrane composition, including LPS modifications , which would necessitate concomitant adaptation of membrane-associated enzymes like lspA.

  • Host-Microbe Interactions: Properly processed lipoproteins are crucial for bacterial adhesion, host colonization, and immune evasion. LspA's role in lipoprotein maturation may be essential for establishing and maintaining the symbiotic relationship with the squid host.

  • Biofilm Formation: Lipoproteins often contribute to biofilm development, which could be important for S. pealeana's persistence in the nidamental gland environment.

To investigate these aspects experimentally, researchers could:

  • Compare lspA activity across a temperature gradient (0-25°C) representative of the squid's environment

  • Generate lspA mutants with altered activity and assess their colonization efficiency in model systems

  • Identify and characterize the specific lipoproteins processed by lspA under symbiotic conditions

  • Perform comparative genomics and transcriptomics between free-living and host-associated states to determine changes in lipoprotein expression and processing

This research would contribute to understanding how essential bacterial processes are adapted for specific ecological niches and host-microbe interactions.

How can structural information from lspA be leveraged for rational design of novel antibiotics with reduced resistance potential?

The structural and functional characteristics of lspA provide an excellent foundation for rational design of novel antibiotics with reduced resistance potential. Several strategies can be employed:

  • Targeting Highly Conserved Active Site Residues:
    The catalytic dyad and 14 additional highly conserved residues surrounding the active site present ideal targets . Mutations in these residues would likely compromise enzyme function, creating a high barrier to resistance development. Structure-based design should focus on compounds that form multiple interactions with these conserved residues.

  • Exploiting Conformational Dynamics:
    Understanding the conformational equilibrium between open and closed states offers opportunities to design inhibitors that lock the enzyme in non-functional conformations . Compounds that stabilize intermediate states similar to how globomycin functions could prevent both substrate binding and catalysis.

  • Dual-Target Inhibitors:
    Designing molecules that simultaneously inhibit lspA and other enzymes in the lipoprotein processing pathway (such as Lgt or Lnt) could dramatically reduce the likelihood of resistance development, as it would require simultaneous mutations in multiple essential proteins.

  • Species-Specific vs. Broad-Spectrum Approaches:
    Comparative analysis of lspA structures across pathogens could identify both conserved binding sites for broad-spectrum activity and unique features for species-specific targeting. This approach could enable precision antimicrobial therapy with reduced impact on beneficial microbiota.

Table 1: Key Structural Features of lspA for Antibiotic Design

Structural FeatureFunctionDesign Implication
Catalytic dyadPeptide bond hydrolysisDirect targeting for competitive inhibition
Periplasmic helixSubstrate recognition and bindingStabilization in closed conformation
β-cradleSubstrate positioningDisruption of substrate-enzyme interactions
Membrane-embedded regionStructural stability and active site positioningLipophilic pharmacophores to enhance membrane penetration

Implementation of these strategies requires iterative cycles of structure-based design, compound synthesis, and biological evaluation using assays that can detect both enzyme inhibition and resistance development frequency. Long-term evolution experiments with sub-inhibitory concentrations could assess the resistance potential of candidate molecules before advancing to more complex models.

What are the major technical challenges in working with recombinant membrane proteins like S. pealeana lspA?

Working with recombinant membrane proteins like S. pealeana lspA presents numerous technical challenges that require specialized approaches:

To address these challenges, researchers should consider:

  • Using specialized expression systems (C43(DE3), Lemo21(DE3)) engineered for membrane protein production

  • Employing fusion partners (MBP, SUMO) to enhance solubility and expression

  • Utilizing nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free purification

  • Incorporating native-like lipid mixtures during reconstitution

  • Exploring cryo-electron microscopy as an alternative to crystallography

These methodological considerations are essential for obtaining functionally relevant data when working with challenging membrane proteins like lspA.

How can researchers validate that in vitro observations of lspA function translate to its in vivo role in bacterial physiology?

Validating that in vitro observations of lspA function accurately reflect its in vivo roles requires a multi-faceted approach spanning molecular, cellular, and physiological techniques:

  • Genetic Approaches:

    • Creation of conditional knockdowns since direct knockouts may be lethal

    • Site-directed mutagenesis of key residues identified in vitro, followed by complementation studies

    • Suppressor mutation screening to identify functional interactions

  • In Situ Activity Monitoring:

    • Development of activity-based protein profiling (ABPP) probes specific for lspA

    • Fluorescent lipoprotein substrates to track processing in living cells

    • Quantitative proteomics to monitor global lipoprotein processing

  • Physiological Response Assessment:

    • Membrane integrity assays under lspA inhibition or depletion

    • Stress response activation measurements

    • Growth rate and morphological analyses under varying conditions

  • Integration of Multiple Evidence Types:

    • Correlation of conformational dynamics observed in vitro with environmental responsiveness in vivo

    • Verification that temperature-dependent effects on activity match physiological adaptations

    • Comparison of inhibitor efficacy in purified systems versus whole cells

A structured approach to validation might include:

Table 2: Validation Framework for lspA Function

In Vitro ObservationIn Vivo Validation MethodExpected Correlation
Substrate specificityLipoprotein processing profiling by proteomicsPreferential processing of predicted substrates
Temperature-dependent activityGrowth complementation at different temperaturesRescue efficiency correlates with in vitro activity
Inhibitor binding modesResistance mutation mappingMutations correspond to predicted binding sites
Conformational dynamicsIn-cell FRET or crosslinkingSimilar conformational states detected

By systematically applying these validation strategies, researchers can establish robust connections between molecular mechanisms observed in purified systems and the physiological roles of lspA in bacterial adaptation, virulence, and survival.

What emerging technologies could revolutionize our understanding of lspA structure-function relationships?

Several cutting-edge technologies are poised to transform our understanding of lspA structure-function relationships, offering unprecedented insights into this important bacterial enzyme:

  • AI-Enhanced Structural Prediction:

    • AlphaFold2 and RoseTTAFold can predict protein structures with remarkable accuracy

    • These tools could model different conformational states of lspA and its complexes with substrates or inhibitors

    • Integration with molecular dynamics simulations could reveal energetically favorable transition pathways

  • Single-Molecule Techniques:

    • Single-molecule FRET (smFRET) to directly observe conformational changes in real-time

    • High-speed atomic force microscopy (HS-AFM) for visualizing dynamic structural changes in membrane-embedded lspA

    • Optical tweezers or magnetic tweezers to measure forces involved in substrate processing

  • Advanced Cryo-EM Methodologies:

    • Time-resolved cryo-EM to capture transient conformational states

    • Cryo-electron tomography with subtomogram averaging for in situ structural determination

    • Microcrystal electron diffraction (MicroED) for high-resolution structures from tiny crystals

  • Integrative Structural Biology:

    • Combining multiple experimental approaches (X-ray, NMR, EPR, SAXS, crosslinking-MS)

    • Computational integration of sparse experimental constraints

    • Network analysis of conformational ensembles rather than single structures

  • Native Mass Spectrometry:

    • Characterization of membrane protein complexes in native-like lipid environments

    • Identification of post-translational modifications and their impact on function

    • Analysis of protein-lipid interactions that modulate activity

  • In-Cell Structural Biology:

    • CRISPR-mediated tagging for in vivo tracking of conformational changes

    • Genetically encoded sensors for enzyme activity monitoring

    • Proximity labeling to map the dynamic interactome of lspA

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.