Recombinant Shewanella pealeana Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Shewanella pealeana Probable Ubiquinone Biosynthesis Protein UbiB

Shewanella pealeana is a Gram-negative, rod-shaped, facultative anaerobic bacterium initially isolated from the nidamental gland of the squid Loligo pealei, indicating its association with marine environments . As a member of the Shewanella genus, this bacterium demonstrates remarkable respiratory versatility, capable of utilizing various electron acceptors including oxygen, nitrate, and metal oxides. This adaptability is facilitated by a complex electron transport system where ubiquinone serves as a critical electron carrier .

The UbiB protein belongs to a family of proteins involved in ubiquinone (coenzyme Q) biosynthesis. In Shewanella pealeana, UbiB is classified as a "probable" ubiquinone biosynthesis protein, suggesting its putative role in this biochemical pathway has been inferred through sequence similarity rather than direct experimental confirmation . The recombinant form of this protein refers to its production through genetic engineering techniques in a host organism (E. coli), enabling its isolation and study in laboratory settings.

Understanding proteins involved in ubiquinone biosynthesis, such as UbiB, provides valuable insights into the metabolic adaptability of Shewanella species across varying environmental conditions. This knowledge has implications for both fundamental microbiology and potential biotechnological applications, given the importance of Shewanella in biogeochemical cycles and bioremediation processes.

Physical and Chemical Properties

The recombinant UbiB protein from Shewanella pealeana possesses several distinctive physical and chemical properties that characterize its molecular identity. This protein is supplied as a lyophilized powder, which enhances its stability during storage and transport . The protein has a full length of 549 amino acids, representing the complete protein sequence encoded by the ubiB gene . Its purity exceeds 90% as determined by SDS-PAGE analysis, making it suitable for a wide range of research applications .

The recombinant protein is stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Trehalose serves as a stabilizing agent, helping to maintain the protein's structural integrity during lyophilization and subsequent storage. The inclusion of a His-tag at the N-terminus facilitates purification through affinity chromatography techniques and provides a consistent method for protein detection in experimental settings .

Ubiquinone Biosynthesis Pathway

Ubiquinone, also known as coenzyme Q, is a lipid-soluble electron carrier that plays a critical role in the respiratory electron transport chain of many bacteria, including Shewanella species. The biosynthesis of ubiquinone involves a complex pathway with multiple enzymatic steps, where UbiB is believed to function as an important component .

In bacterial systems, ubiquinone biosynthesis typically begins with chorismate, which undergoes a series of transformations involving several Ubi proteins. While the exact role of UbiB in this pathway has not been fully characterized in Shewanella pealeana specifically, studies in related organisms suggest it may function as a kinase or kinase-like protein involved in one of the monooxygenation steps of ubiquinone biosynthesis . This step requires oxygen, which aligns with the role of ubiquinone in aerobic respiration.

Most Shewanella species are facultative anaerobes that produce both ubiquinones and menaquinones . Ubiquinones are primarily associated with aerobic respiration, while menaquinones are more commonly utilized in anaerobic respiration. The regulation of quinone biosynthesis in Shewanella is likely oxygen-dependent, allowing these bacteria to adapt to changing environmental conditions by modulating their respiratory pathways .

Functional Implications in Shewanella pealeana

In Shewanella pealeana, UbiB's function may be specifically adapted to the organism's marine environment and potential symbiotic relationships. The ability to produce ubiquinone would be particularly important for S. pealeana in oxygen-rich environments or during transitions between aerobic and anaerobic conditions, which are common in marine settings .

The designation of this protein as a "probable" ubiquinone biosynthesis protein indicates that its function has been inferred based on sequence similarity to known UbiB proteins in other organisms rather than through direct experimental verification in S. pealeana specifically . This highlights an area for future research to definitively characterize the protein's role in this particular species.

Reconstitution Protocol

Proper reconstitution of the lyophilized UbiB protein is essential for maintaining its structural integrity and functional activity. According to the product information, the following reconstitution protocol is recommended :

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom, preventing loss of product

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  4. Aliquot the solution for long-term storage to avoid repeated freeze-thaw cycles

This reconstitution process is designed to optimize protein stability and minimize potential degradation during subsequent experimental use .

Functional Studies and Characterization

The recombinant UbiB protein from Shewanella pealeana serves as a valuable tool for functional studies aimed at elucidating its specific role in ubiquinone biosynthesis. Potential research applications include enzymatic assays to characterize its predicted kinase activity, interaction studies to identify binding partners within the ubiquinone biosynthesis pathway, and structural studies to determine its three-dimensional conformation .

These investigations could provide important insights into bacterial energy metabolism and adaptation mechanisms, particularly in the context of Shewanella species' remarkable respiratory versatility. Understanding UbiB function has broader implications for our comprehension of how bacteria regulate their electron transport systems in response to environmental changes .

Comparative Analysis with Other Shewanella Species

The availability of recombinant UbiB from Shewanella pealeana enables comparative studies with UbiB proteins from other Shewanella species and even other bacterial genera. Most Shewanella species are facultative anaerobes that produce both ubiquinones and menaquinones, with the regulation of quinone biosynthesis likely being oxygen-dependent .

Comparative analyses could reveal evolutionary adaptations in ubiquinone biosynthesis pathways related to the specific ecological niches occupied by different Shewanella species. Such studies would contribute to our understanding of how these bacteria have adapted their respiratory strategies to diverse environmental conditions, from deep-sea to freshwater habitats .

Functional Validation in Shewanella pealeana

These studies would move the protein's classification from "probable" to definitively characterized, enhancing our understanding of ubiquinone biosynthesis in this specific marine bacterium. Furthermore, functional validation studies could reveal species-specific adaptations in the ubiquinone biosynthesis pathway that relate to S. pealeana's unique ecological niche and physiological requirements.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
ubiB; Spea_3794; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Target Names
ubiB
Target Protein Sequence
MTVKSIRRAYHVIRTALHYGLDDLLPPKLTPWYFKLLRYCFFWLRNQHKDKVGGERLKLA MQELGPVYIKFGQMLSTRRDLLSDEWAEELAMLQDRVPPFDSAIARESIEKELNAPIERY FNDFDDTPLASASISQVHTATLKSNGAAVVLKVLRPDVEKKVHADLLLMSQAADFLERLL GANNRLRPAEVVEDYRTTIEGELNLKLEALNAIKLRNNFIDSNALYIPYMYEELCFTRLI VMERIDGIPVSDKVALEAQGTNLKLLAERGVELFFTQVFRDNFFHADMHPGNVFVSREHP NDPFYIGLDCGIMGTLTDEDKRYLAENFLAFFNRDYRRIAQLYIESGWVSADTDVGAFEQ AVKVVCEPMFNKPLDEISFGHVLLELFRTARRFDMVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLEQWMAEQVGPKAMAAKVKQQLPYWAEHLPELPELIYDNLKIGRDLSKN QNKLLDRYLKHQQKAHKSNYLLITSAILVICGTILLNQDATLWPSYGSIGIGITLWVLGW RSRPKNRKI
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which plays a role in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella pealeana and what ecological niche does it occupy?

Shewanella pealeana is a gram-negative bacterium belonging to the genus Shewanella. It primarily exists in marine environments and has been identified as a symbiont or epibiont organism . S. pealeana was isolated from shallow-water marine sediments derived from the Amazon River delta and is characterized by its ability to thrive in cold marine environments . Like other Shewanella species, S. pealeana has adapted to specific ecological niches through genomic evolution and acquisition of various functional genes that enhance its survival in these environments .

What is the function of ubiquinone biosynthesis protein UbiB in bacterial systems?

UbiB is a probable protein kinase involved in the ubiquinone (coenzyme Q) biosynthesis pathway . Ubiquinone is an essential component of the electron transport chain in cellular respiration. In Shewanella species, which are known for their diverse respiratory capabilities and ability to use various electron acceptors, UbiB plays a critical role in energy metabolism . The protein facilitates electron transfer processes that are particularly important for Shewanella's anaerobic respiration capabilities, including metal reduction .

What is the structural composition of S. pealeana UbiB protein?

The S. pealeana UbiB protein is composed of 549 amino acids with a specific sequence that has been fully characterized . The primary structure includes multiple functional domains conserved across UbiB proteins. The three-dimensional structure features regions responsible for protein-protein interactions and enzymatic activity. When expressed recombinantly, it is typically tagged with a histidine tag at the N-terminus to facilitate purification and detection .

What expression systems are most effective for recombinant production of S. pealeana UbiB?

Escherichia coli is the most commonly used expression system for S. pealeana UbiB protein production . For optimal expression, the full-length UbiB gene (1-549aa) is typically cloned into an expression vector that includes an N-terminal His-tag sequence. Expression conditions must be carefully controlled, including induction timing, temperature, and media composition. The protein is subsequently harvested and purified using affinity chromatography methods that exploit the His-tag . Testing multiple E. coli strains such as BL21(DE3), Rosetta, or Arctic Express may improve soluble protein yield.

What purification strategies yield the highest purity and activity for recombinant S. pealeana UbiB?

The most effective purification strategy involves a multi-step approach:

  • Initial capture using nickel affinity chromatography (Ni-NTA) exploiting the His-tag

  • Secondary purification via ion exchange chromatography to separate based on charge differences

  • Size exclusion chromatography for final polishing and buffer exchange

This approach typically yields protein with purity greater than 90% as determined by SDS-PAGE . For maintaining enzymatic activity, purification should be performed at 4°C with the addition of stabilizing agents such as glycerol (5-50%) in the storage buffer .

How can researchers assess the functional activity of purified recombinant S. pealeana UbiB?

Functional assessment of recombinant S. pealeana UbiB can be performed through several approaches:

  • Enzymatic assays: Measuring kinase activity using ATP consumption assays

  • Complementation studies: Testing whether the recombinant UbiB can restore ubiquinone biosynthesis in UbiB-deficient bacterial strains

  • Electron transport chain analysis: Evaluating the impact on respiratory functions when the protein is added to membrane fractions

  • Binding assays: Analyzing interactions with other components of the ubiquinone biosynthesis pathway

Results should be compared with those from well-characterized UbiB proteins from related organisms such as S. oneidensis .

How does S. pealeana UbiB compare structurally and functionally with homologous proteins in other Shewanella species?

Comparative analysis reveals significant similarities between S. pealeana UbiB and homologous proteins in other Shewanella species. For example, S. oneidensis UbiB shows high sequence similarity but contains key differences in specific amino acid regions . The table below summarizes key comparisons:

SpeciesUniProt IDProtein LengthSequence SimilarityKey Functional Differences
S. pealeanaA8H968549 aaReferenceMore hydrophobic C-terminal region
S. oneidensisQ8E9R5549 aa~85%Variations in membrane-binding domains
S. putrefaciens(Not specified)~549 aa~80%Differences in ATP-binding motifs
S. baltica(Not specified)~549 aa~75%Altered substrate specificity regions

These differences likely reflect adaptations to the specific environmental conditions each species encounters .

What role does UbiB play in the unique respiratory capabilities of Shewanella species?

Shewanella species are known for their remarkable respiratory versatility, particularly their ability to reduce metals and other electron acceptors . UbiB contributes to this capability by:

  • Supporting ubiquinone biosynthesis, which is essential for electron transport chain function

  • Facilitating adaptation to varying oxygen levels, as Shewanella can shift between aerobic and anaerobic respiration

  • Contributing to the electron transfer processes required for metal reduction

  • Potentially interacting with cytochromes and other respiratory proteins that are abundant in Shewanella species

The respiratory chains of Shewanella strains are highly diversified, allowing them to utilize various electron acceptors . UbiB's role in ubiquinone biosynthesis is critical for maintaining this respiratory flexibility.

How does horizontal gene transfer influence the evolution of ubiquinone biosynthesis pathways in Shewanella species?

Genomic analyses of Shewanella species reveal extensive horizontal gene transfer (HGT) events that have shaped their metabolic capabilities . For ubiquinone biosynthesis genes:

  • Mobile genetic elements (MGEs) have facilitated the transfer of biosynthetic genes between strains and species

  • Genomic islands containing clusters of genes related to respiratory functions, including ubiquinone biosynthesis, show evidence of HGT

  • Comparative genomic analyses indicate that UbiB and related proteins may have undergone selection pressures related to adaptation to specific environments

  • The diversity in ubiquinone biosynthesis pathways across Shewanella species reflects their adaptation to different ecological niches

This evolutionary plasticity has allowed Shewanella to develop diverse respiratory strategies for survival in varied environments .

What are the critical parameters for designing gene editing experiments targeting UbiB in Shewanella species?

When designing gene editing experiments targeting UbiB in Shewanella species, researchers should consider:

  • Selection of appropriate genetic tools: CRISPR/Cas9 systems coupled with single-stranded DNA oligonucleotide recombineering have shown high efficiency (>90%) in Shewanella genome editing

  • sgRNA design: Target sequences should be specific to UbiB while avoiding off-target effects

  • Homology arm design: For precise modifications, homology arms should be designed with sufficient length (typically 40-60 bp) flanking the target site

  • Screening strategies: Phenotypic screens based on respiratory capabilities can identify successful UbiB modifications

  • Verification methods: Sequencing and functional assays should confirm intended genetic changes

The dual-plasmid system described for Shewanella, utilizing both a sgRNA targeting vector and an editing vector harboring Cas9 and phage recombinase W3 Beta, provides a versatile platform for these experiments .

How can researchers design experiments to investigate the role of UbiB in Shewanella's metal reduction capabilities?

To investigate UbiB's role in metal reduction, researchers should design experiments that:

  • Create UbiB knockout mutants: Using CRISPR/Cas9 or traditional homologous recombination techniques to generate UbiB-deficient strains

  • Perform complementation studies: Reintroduce wild-type or modified UbiB to confirm phenotype rescue

  • Conduct metal reduction assays: Compare rates of Fe(III), Mn(IV), and other metal reduction between wild-type and mutant strains

  • Analyze respiratory chain components: Examine changes in cytochrome expression and localization

  • Perform electron transport measurements: Measure electron transfer rates to external acceptors

These experiments should be conducted under both aerobic and anaerobic conditions, as Shewanella species demonstrate different respiratory behaviors depending on oxygen availability .

What approaches can resolve solubility issues when expressing recombinant S. pealeana UbiB?

Solubility issues are common when expressing membrane-associated proteins like UbiB. Researchers can:

  • Optimize expression conditions: Lower induction temperature (16-20°C), reduce inducer concentration, and extend expression time

  • Modify buffer composition: Include solubilizing agents such as mild detergents (0.1% Triton X-100 or n-dodecyl β-D-maltoside)

  • Create fusion constructs: Express UbiB with solubility-enhancing fusion partners such as MBP or SUMO

  • Use specialized E. coli strains: Select strains designed for membrane protein expression

  • Implement inclusion body refolding: If UbiB forms inclusion bodies, develop a refolding protocol using a urea gradient

Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 and the addition of 5-50% glycerol has been found effective for maintaining solubility during storage .

How should inconsistencies in UbiB functional assay results be interpreted and addressed?

When facing inconsistencies in UbiB functional assays, researchers should:

  • Verify protein integrity: Confirm the absence of degradation using SDS-PAGE and western blotting

  • Check for proper folding: Use circular dichroism or limited proteolysis to assess structural integrity

  • Optimize assay conditions: Systematically vary buffer components, pH, temperature, and substrate concentrations

  • Consider post-translational modifications: Investigate whether specific modifications present in native UbiB are absent in recombinant versions

  • Examine protein-protein interactions: Determine if UbiB requires interaction partners for full activity

For Shewanella proteins, considering the organism's adaptation to specific environmental conditions (such as cold marine environments) may be particularly important when interpreting functional data .

What experimental controls are essential when studying the involvement of UbiB in ubiquinone biosynthesis?

Critical experimental controls include:

  • Positive controls: UbiB proteins from well-characterized organisms with confirmed activity

  • Negative controls: Enzymatically inactive UbiB mutants (e.g., ATP-binding site mutations)

  • Complementation controls: Testing whether UbiB from S. pealeana can complement UbiB deficiency in other species

  • Background activity controls: Measuring activity in host cells lacking endogenous UbiB

  • Substrate specificity controls: Testing activity with alternative substrates to confirm specificity

These controls help distinguish UbiB's direct contributions from indirect effects or experimental artifacts when studying ubiquinone biosynthesis pathways .

How might understanding S. pealeana UbiB function contribute to bioremediation applications?

Shewanella species are known for their metal-reducing capabilities, making them valuable for bioremediation of metal-contaminated sites . Understanding UbiB's role could advance bioremediation through:

  • Enhancing electron transfer to toxic metals, accelerating their conversion to less toxic forms

  • Engineering strains with optimized UbiB function for improved metal reduction efficiency

  • Developing UbiB-based biosensors for detecting environmental contaminants

  • Creating bioreactor systems that leverage UbiB's role in respiratory flexibility for treating multiple contaminants simultaneously

  • Understanding adaptation mechanisms to harsh environments, enabling deployment in challenging contaminated sites

These applications build on Shewanella's natural ability to reduce a diverse range of metals and other electron acceptors .

What evolutionary insights can be gained from studying UbiB across diverse Shewanella species?

Comparative analysis of UbiB across Shewanella species provides valuable evolutionary insights:

  • Tracking adaptive evolution in respiratory pathways as Shewanella species colonized different ecological niches

  • Understanding how genomic exchanges with deep-sea bacterial genomes influenced ubiquinone biosynthesis

  • Identifying selective pressures that drive the diversification of respiratory systems

  • Mapping horizontal gene transfer events that contributed to respiratory flexibility

  • Correlating genomic adaptations (such as G+C content and amino acid composition changes) with cold adaptation mechanisms

These insights connect UbiB evolution to the broader context of how bacteria adapt their energy metabolism to specific environmental challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.