Recombinant Shewanella pealeana Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Shewanella pealeana Protease HtpX is a heat shock-inducible enzyme (EC 3.4.24.-) encoded by the htpX gene. It is expressed in Escherichia coli and purified for laboratory use. Key properties include:

PropertyDetail
Source OrganismShewanella pealeana (strain ATCC 700345/ANG-SQ1)
UniProt IDA8H3J1
Expression SystemE. coli
TagDetermined during production (commonly His-tag in homologs)
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C

Comparative Analysis with Homologs

FeatureS. pealeana HtpX (A8H3J1)S. baltica HtpX (A6WPJ1)
Host SpeciesS. pealeanaS. baltica
Sequence Length287 aa287 aa
Expression TagVariableN-terminal His-tag
Key ApplicationsProtein degradation studiesStructural/functional assays

Research and Industrial Applications

  • Biochemical Studies:
    Used to investigate metalloprotease mechanisms, substrate specificity, and stress-response pathways .

  • Antibiotic Resistance:
    Homologs in pathogenic bacteria (e.g., S. maltophilia) suggest potential as adjuvant targets to enhance aminoglycoside efficacy .

  • Food Safety:
    Shewanella proteases are implicated in meat spoilage , though HtpX’s direct role requires validation.

Future Research Directions

  • Elucidate substrate specificity and regulatory mechanisms in S. pealeana.

  • Explore HtpX’s role in antibiotic resistance using knockout models.

  • Investigate industrial applications in protein engineering or biocatalysis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
htpX; Spea_1805; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Target Names
htpX
Target Protein Sequence
MKRIFLLIATNMAILLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDNTERWLVETVARQAEQAGIKMPEVAIYQSPELNAFATGPSKDNSLVAV SSGLLYGMNQDEIEAVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIIDNFVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASMIVAYFSRIREYRADEGAAKLAGKEKMIAAL DRLRQGPETGAMPASMSALGINGKKSMAELMMSHPPLEKRIEALRAH
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and what is its role in bacterial physiology?

HtpX is a membrane-bound zinc metalloproteinase belonging to the M48 family that plays a crucial role in the quality control of membrane proteins. In bacterial systems such as Escherichia coli and Shewanella species, HtpX functions primarily to eliminate malfolded and/or misassembled membrane proteins that could potentially disrupt membrane integrity and cellular function . The protein is expressed as part of the heat shock regulon, with its expression being induced during temperature upshift and regulated by a sigma 32-dependent promoter .

While gene disruption studies in E. coli have shown that cells carrying an htpX gene disruption can grow well under various tested conditions without apparent phenotype, cells overexpressing a truncated form of the protein display enhanced degradation of puromycyl peptides, suggesting its role in protein quality surveillance . This function is particularly important for maintaining normal cellular activities under stress conditions when protein misfolding may increase.

How is the expression of HtpX regulated in bacterial cells?

HtpX expression is primarily regulated as part of the heat shock response system. In E. coli, and likely in Shewanella species as well, htpX is expressed from a sigma 32-dependent promoter, classifying it as a component of the heat shock regulon . The protein is expressed as a 32-kDa protein from a monocistronic transcript, with expression being significantly induced during temperature upshift .

This regulation mechanism ensures that HtpX is available in increased amounts during stress conditions when protein misfolding is more likely to occur, supporting its role in protein quality control. The coordinated expression with other heat shock proteins allows for a comprehensive cellular response to proteotoxic stress, maintaining membrane integrity and function under adverse conditions.

What methodologies can be used to assess HtpX protease activity in vivo?

Researchers have developed several approaches to evaluate HtpX protease activity in bacterial systems. A notable advancement is an in vivo semiquantitative protease activity assay system specifically designed for HtpX . This system involves:

  • Construction of a model substrate (designated as XMS1 in published research)

  • Expression of this substrate in bacterial cells with varying levels of HtpX

  • Detection of proteolytic cleavage products using immunoblotting techniques

The system enables detection of differential protease activities of HtpX mutants carrying mutations in conserved regions, allowing researchers to assess the impact of specific amino acid changes on protease function . This methodology is particularly valuable because it addresses the previous challenge of lacking physiological substrates and sensitive detection methods for HtpX activity.

For quantification, researchers can measure the ratio of cleaved fragments (both N-terminal and C-terminal fragments) to the full-length substrate, providing a semiquantitative assessment of protease activity under different experimental conditions.

How do mutations in conserved regions affect the proteolytic function of HtpX?

Mutations in conserved regions of HtpX significantly impact its proteolytic function, with effects varying based on the specific residues affected. The in vivo protease activity assay system mentioned above has been instrumental in characterizing these effects .

Key findings from mutation studies include:

Mutation TypeRegion AffectedImpact on Proteolytic ActivityPotential Mechanism
Active site mutationsZinc-binding motifsSevere reduction or elimination of activityDisruption of metal coordination essential for catalysis
Transmembrane region mutationsHydrophobic segmentsVariable effects on activity and substrate specificityAltered membrane positioning and substrate access
Conserved non-catalytic residuesVarious domainsSubtle to moderate effects on activityDisruption of protein folding, substrate binding, or allosteric regulation

What are the approaches for recombinant expression and purification of active HtpX?

Successful expression and purification of recombinant HtpX requires specialized approaches due to its membrane-integrated nature. Based on protocols for similar membrane proteases, the following methodology is recommended:

  • Expression System Selection: E. coli is commonly used for recombinant expression of Shewanella proteins. For HtpX from Shewanella halifaxensis, expression with an N-terminal His tag has been successfully implemented .

  • Expression Conditions:

    • Induction at moderate temperatures (20-25°C) to facilitate proper folding

    • Use of specialized E. coli strains designed for membrane protein expression

    • Controlled induction to prevent toxicity from membrane protein overexpression

  • Purification Protocol:

    • Cell lysis in buffer containing appropriate detergents (typically mild non-ionic detergents)

    • Affinity chromatography using Ni-NTA or similar matrices for His-tagged proteins

    • Size exclusion chromatography for further purification

    • Maintenance of detergent above critical micelle concentration throughout purification

  • Storage Recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

The purified protein can be maintained in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for optimal stability .

How can genome editing techniques be applied to study HtpX function in Shewanella species?

Recent advances in genetic manipulation techniques for Shewanella species have opened new possibilities for studying HtpX function through precise genome editing. A particularly promising approach involves prophage-mediated genome engineering (recombineering) using a λ Red Beta homolog from Shewanella sp. W3-18-1 .

This system enables:

  • Precise Genomic Modifications:

    • Introduction of point mutations in the htpX gene to study structure-function relationships

    • Creation of deletion mutants to assess phenotypic consequences

    • Insertion of reporter tags for monitoring expression and localization

  • Methodology Implementation:

    • Transformation of Shewanella cells with the recombineering system (efficiency ~4.0 x 10^6 transformants/μg DNA)

    • Design of single-stranded DNA oligonucleotides targeting the htpX locus

    • Selection and verification of recombinants

    • Phenotypic characterization under various stress conditions

  • Advantages for HtpX Research:

    • Eliminates the need for antibiotic selection markers

    • Allows for subtle modifications that maintain reading frame

    • Enables systematic mutagenesis of conserved residues

    • Facilitates creation of conditional mutants for essential functions

The W3 Beta recombinase system has demonstrated high efficiency, with approximately 5 × 10^6 recombinants obtained per 10^8 viable cells , making it a powerful tool for investigating HtpX function through precise genetic manipulation.

How does HtpX coordinate with other proteases in the quality control of membrane proteins?

HtpX functions as part of a comprehensive membrane protein quality control network in bacterial cells. Research suggests that HtpX works cooperatively with other proteases, particularly FtsH, another membrane-bound protease involved in protein quality control .

The coordination between these proteases appears to involve:

  • Complementary Substrate Specificity:

    • HtpX may recognize and cleave specific structural motifs in misfolded membrane proteins

    • FtsH has been shown to preferentially degrade certain classes of membrane proteins

    • Together, they provide comprehensive surveillance of membrane protein integrity

  • Sequential Processing:

    • In some cases, initial cleavage by HtpX may generate fragments that are subsequently degraded by FtsH or cytoplasmic proteases

    • This stepwise degradation ensures complete elimination of potentially harmful protein species

  • Regulatory Interactions:

    • Evidence suggests potential cross-regulation between different proteolytic systems

    • Upregulation of HtpX has been observed in conditions where other proteases are compromised

Understanding these coordinated interactions is essential for a complete picture of membrane protein homeostasis and provides insights into bacterial adaptation to stress conditions.

What experimental approaches can detect interactions between HtpX and its substrates?

Identifying and characterizing interactions between HtpX and its substrates presents significant challenges due to the transient nature of protease-substrate interactions and the membrane-embedded context. Several experimental approaches have proven useful:

  • Cross-linking Studies:

    • Chemical cross-linking coupled with mass spectrometry

    • Site-specific photo-cross-linking with unnatural amino acids incorporated into HtpX

    • These approaches can capture transient interactions before proteolytic cleavage occurs

  • Substrate Trapping:

    • Generation of catalytically inactive HtpX mutants that bind but do not cleave substrates

    • Pull-down assays using tagged versions of these "substrate traps"

    • Mass spectrometric identification of captured potential substrates

  • In Vivo Substrate Identification:

    • Comparative proteomics of wild-type and htpX-deficient strains

    • Pulse-chase experiments to track substrate degradation kinetics

    • Newly developed model substrate systems that facilitate detection of HtpX activity

  • Structural Studies:

    • Cryo-electron microscopy of HtpX-substrate complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Computational modeling based on structural constraints

These approaches, used in combination, provide complementary information about HtpX-substrate interactions and contribute to a more complete understanding of substrate recognition and processing mechanisms.

What are the implications of HtpX research for understanding bacterial stress responses?

Research on HtpX proteases has significant implications for understanding bacterial adaptation to stress conditions, particularly in environmentally versatile organisms like Shewanella species. Key insights include:

  • Temperature Adaptation:

    • As a heat shock protein, HtpX helps bacteria adapt to temperature fluctuations by removing damaged membrane proteins

    • This function is particularly relevant for Shewanella species, which inhabit diverse temperature environments

  • Membrane Integrity Maintenance:

    • By eliminating misfolded membrane proteins, HtpX preserves membrane function under stress conditions

    • This protection extends to maintenance of crucial membrane-associated processes such as electron transport

    • For Shewanella species, known for their diverse respiratory capabilities, this function may be particularly important

  • Potential Role in Antimicrobial Resistance:

    • Membrane protein quality control may contribute to resilience against antimicrobial compounds that target membrane integrity

    • Understanding these mechanisms could inform strategies to overcome bacterial resistance

  • Environmental Adaptation:

    • In Shewanella species, which inhabit diverse ecological niches from marine environments to deep-sea sediments, membrane protein quality control likely contributes to their remarkable environmental adaptability

    • HtpX may help maintain critical membrane functions under varying conditions of salinity, pressure, and redox potential

Further research on HtpX in Shewanella species will continue to illuminate these broader implications for bacterial physiology and adaptation to challenging environments.

What are the current research gaps in understanding HtpX function in Shewanella species?

Despite significant advances, several important aspects of HtpX function in Shewanella species remain unclear:

  • Physiological Substrates: While model substrates have been developed for assaying HtpX activity, the identification of natural substrates in Shewanella species remains limited. Comprehensive proteomics approaches are needed to identify the physiological targets of HtpX under various growth conditions.

  • Regulatory Networks: The integration of HtpX within broader stress response networks in Shewanella is not fully characterized. Further research is needed to map the regulatory connections between HtpX expression and other stress response systems.

  • Species-Specific Functions: The functional differences of HtpX across diverse Shewanella species, which inhabit significantly different environments, warrant further investigation. Comparative studies could reveal adaptations of this protease system to specific ecological niches.

  • Structural Characterization: High-resolution structural information for Shewanella HtpX proteins is currently lacking. Structural studies would provide insights into substrate recognition, catalytic mechanism, and membrane integration.

Addressing these research gaps will contribute to a more comprehensive understanding of membrane protein quality control in Shewanella species and bacterial systems more broadly.

How might future technologies advance the study of HtpX proteases?

Emerging technologies offer promising avenues for addressing current challenges in HtpX research:

  • Cryo-Electron Microscopy: Advances in cryo-EM techniques for membrane proteins may enable structural determination of HtpX in its native membrane environment, potentially revealing the precise arrangement of transmembrane segments and substrate-binding sites.

  • Single-Molecule Techniques: Methods such as single-molecule FRET could provide insights into the dynamics of HtpX-substrate interactions and conformational changes during the catalytic cycle.

  • Advanced Genome Editing: Further refinement of the prophage-mediated genome engineering system for Shewanella will enable more sophisticated genetic manipulations, including the creation of conditional mutants and precise regulatory modifications.

  • Synthetic Biology Approaches: Designer substrates and biosensors for HtpX activity could facilitate high-throughput screening of conditions affecting protease function and potentially identify modulators of activity.

  • Systems Biology Integration: Multi-omics approaches integrating transcriptomics, proteomics, and metabolomics data could position HtpX function within global cellular networks and reveal unexpected connections to other biological processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.