Recombinant Shewanella pealeana UPF0761 membrane protein Spea_3909 (Spea_3909)

Shipped with Ice Packs
In Stock

Description

Key Sequence Features:

FeatureDetails
Amino Acid SequenceMKNKIAINQVRSFLLSIWAFFLHLLSRFKEDQVNIKAGHLAYVTLLSLVPIVAVMFSmLS...
Post-Translational ModificationsNone reported; tag type determined during production
Secondary Structure PredictionPredicted transmembrane domains consistent with membrane localization

Production and Purification

  • Host System: Recombinant expression system (unspecified, likely E. coli).

  • Purity: ≥90% (SDS-PAGE verified) .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C/-80°C .

Biochemical Properties:

PropertyValue/Result
SolubilityOptimized in Tris buffer with glycerol
StabilityDegrades upon repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤7 days

Comparative Genomic Analysis:

  • Conserved Domains: Homologs of Spea_3909 in related Shewanella species are linked to nutrient transport or metal ion binding .

  • Virulence Associations: Shewanella membrane proteins often interact with host tissues during infection, though Spea_3909’s role in pathogenicity is unconfirmed .

Applications and Research Use

  • Biotechnological Potential: Proteins from Shewanella spp. are used in bioremediation and bioenergy applications (e.g., microbial fuel cells) . Spea_3909 could serve as a candidate for studying metal-ion interactions.

  • Immunological Studies: Recombinant Spea_3909 is marketed for ELISA development, suggesting utility in antibody production or diagnostic assays .

Limitations and Knowledge Gaps

  • Functional Characterization: No peer-reviewed studies directly investigate Spea_3909’s enzymatic activity or physiological role.

  • Structural Data: Lack of crystallography or NMR data limits mechanistic insights.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Spea_3909; UPF0761 membrane protein Spea_3909
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Target Names
Spea_3909
Target Protein Sequence
MKNKIAINQVRSFLLSIWAFFLHLLSRFKEDQVNIKAGHLAYVTLLSLVPIVAVMFSMLS AFPVFSGIREKLEGFVYDNFLPAAGDTVQIYINEFVANASKGTSVGIVALMVVALMLISA IDKALNSIWRTKEKRQAAVSFSMYWMVLTLGPVLVGASLVATSYIVSLKLFSETELSGVV PILIERLPMLFSVAAFLLLYMVVPIKKVKFLHALLGALVAAMLFELGKKGFAFYVTQFPS YEAIYGALATIPILFVWVYVSWVIVLVGAEITAGLPEYLHECKLIRETALAESQAETKTE EPVTESKNDGPNSSNDSGQDNVRGSEKTDEPAQDKQDKLD
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Spea_3909 protein?

For optimal expression of recombinant Spea_3909, E. coli-based expression systems are commonly employed, particularly those optimized for membrane proteins. BL21(DE3) or C41/C43(DE3) strains are recommended due to their tolerance for membrane protein overexpression. For enhanced yields, consider the following methodological approaches:

  • Temperature modulation: Expression at lower temperatures (16-20°C) after induction often increases proper folding.

  • Induction optimization: IPTG concentration between 0.1-0.5 mM with induction at mid-log phase (OD600 of 0.6-0.8).

  • Media supplementation: Addition of glycerol (0.5-1%) and specific metal ions may enhance expression.

  • Fusion tag selection: N-terminal 6xHis tag combined with a solubility-enhancing partner (MBP or SUMO) improves both expression and purification efficiency.

The recombinant protein is typically stored in Tris-based buffer with 50% glycerol and should be maintained at -20°C for standard storage or -80°C for extended periods to preserve activity.

What are the taxonomic and ecological contexts of Shewanella pealeana relevant to Spea_3909 research?

Shewanella pealeana belongs to the following taxonomic hierarchy:

  • Kingdom: Bacteria

  • Phylum: Proteobacteria

  • Class: Gammaproteobacteria

  • Order: Alteromonadales

  • Family: Shewanellaceae

  • Genus: Shewanella

  • Species: Shewanella pealeana

Ecologically, S. pealeana is a marine bacterium that has been identified in multiple marine environments, particularly along the Australian coast. Records from 2010-2021 show its presence in:

DatasetRecordsLocation
Port Hacking NRS12New South Wales, Australia
bioGEOTRACES project12Various marine environments
Maria Island NRS1Tasmania, Australia
North Stradbroke Island NRS1Queensland, Australia

This ecological distribution may influence Spea_3909's functional adaptations, as membrane proteins often play crucial roles in environmental adaptation and stress responses.

What are the optimal purification strategies for Spea_3909 that preserve structural integrity?

Purification of membrane proteins like Spea_3909 requires specialized approaches to maintain structural integrity. A recommended multi-step purification protocol includes:

  • Membrane fraction isolation:

    • Harvest cells via centrifugation (5,000×g, 15 min, 4°C)

    • Resuspend in buffer containing protease inhibitors

    • Disrupt cells via sonication or pressure-based methods

    • Remove unbroken cells and debris (10,000×g, 20 min, 4°C)

    • Ultracentrifuge to isolate membrane fraction (100,000×g, 1 hr, 4°C)

  • Solubilization optimization:

    • Test multiple detergents (DDM, LMNG, LDAO) at concentrations 2-5× their CMC

    • Incubate at 4°C with gentle agitation for 1-2 hours

    • Remove insoluble material via ultracentrifugation (100,000×g, 30 min, 4°C)

  • Affinity chromatography:

    • Apply solubilized material to Ni-NTA column equilibrated with detergent-containing buffer

    • Implement gradient elution with imidazole (20-500 mM)

    • Reduce detergent concentration to 1-2× CMC in elution buffer

  • Gel filtration:

    • Apply concentrated protein to Superdex 200 column

    • Monitor protein oligomeric state and homogeneity

This multi-step approach typically yields >85% pure protein suitable for structural and functional studies.

How can researchers effectively analyze the membrane topology of Spea_3909?

Multiple complementary techniques should be employed to accurately determine Spea_3909's membrane topology:

  • Computational prediction:

    • TMHMM, HMMTOP, and Phobius algorithms suggest 7-8 transmembrane domains

    • Hydrophobicity plot analysis reveals alternating hydrophobic and hydrophilic segments

  • Cysteine scanning mutagenesis:

    • Systematically replace native residues with cysteines

    • Probe accessibility using membrane-permeable and impermeable thiol-reactive reagents

    • Analyze accessibility patterns to determine cytoplasmic vs. periplasmic loops

  • Protease protection assays:

    • Prepare inside-out and right-side-out membrane vesicles

    • Treat with proteases (trypsin, chymotrypsin)

    • Analyze digestion patterns via Western blotting with domain-specific antibodies

  • GFP fusion analysis:

    • Create C-terminal and internal GFP fusions

    • Fluorescence indicates cytoplasmic localization

The consensus from these methods helps build a reliable topological model of Spea_3909, essential for understanding structure-function relationships.

What experimental approaches can determine potential binding partners of Spea_3909?

To identify Spea_3909 interaction partners, employ multiple orthogonal approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express epitope-tagged Spea_3909 in native host or heterologous system

    • Crosslink in vivo with formaldehyde or DSP (0.1-1%)

    • Purify under gentle conditions maintaining protein complexes

    • Identify co-purifying proteins via LC-MS/MS

    • Validate interactions by reciprocal pulldowns

  • Bacterial two-hybrid screening:

    • Create bait constructs with Spea_3909 domains

    • Screen against genomic library of S. pealeana

    • Validate positive interactions with targeted assays

  • Chemical crosslinking coupled with MS:

    • Use membrane-permeable crosslinkers with varying spacer lengths

    • Digest crosslinked complexes and analyze by MS

    • Identify crosslinked peptides using specialized algorithms

  • Co-evolution analysis:

    • Perform bioinformatic analysis of co-evolving residues across species

    • Identify statistically significant co-evolution patterns suggesting functional interactions

These approaches collectively provide a comprehensive interactome map for understanding Spea_3909's biological context.

How can researchers assess the role of Spea_3909 in membrane transport processes?

To evaluate Spea_3909's potential role in membrane transport, implement these methodological approaches:

  • Liposome reconstitution assays:

    • Purify Spea_3909 to >90% homogeneity

    • Reconstitute into liposomes with varying lipid compositions

    • Encapsulate fluorescent indicators for relevant ions/metabolites

    • Measure flux rates under varying conditions (pH, ion gradients)

    • Calculate kinetic parameters (Km, Vmax) for transported substrates

  • Whole-cell transport assays:

    • Create knockout and overexpression strains

    • Measure uptake/efflux of radiolabeled or fluorescent substrates

    • Compare transport rates between wild-type and modified strains

    • Perform competition assays to determine substrate specificity

  • Patch-clamp electrophysiology:

    • Express Spea_3909 in suitable host cells (Xenopus oocytes or mammalian cells)

    • Record channel/transporter activity under voltage clamp

    • Characterize electrophysiological properties (conductance, gating, ion selectivity)

  • Microscale thermophoresis (MST):

    • Label purified Spea_3909 with fluorescent dye

    • Measure binding affinities with potential substrates

    • Determine KD values across concentration ranges

These approaches provide complementary insights into Spea_3909's transport function and substrate specificity.

What structural biology techniques are most applicable for resolving Spea_3909's molecular architecture?

For comprehensive structural characterization of Spea_3909, consider these advanced methodological approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Prepare monodisperse protein in amphipols or nanodiscs

    • Collect high-resolution images (300kV microscope with direct electron detector)

    • Process data using motion correction and CTF estimation

    • Perform 3D reconstruction targeting 3-4Å resolution

    • Advantages: Works with smaller amounts of protein; captures multiple conformational states

  • X-ray crystallography:

    • Screen detergents and lipid cubic phase formulations

    • Optimize crystal growth using vapor diffusion, batch, or LCP methods

    • Include stabilizing ligands or antibody fragments

    • Collect diffraction data at synchrotron beamlines

    • Advantages: Potentially higher resolution; well-established phase determination methods

  • Nuclear magnetic resonance (NMR):

    • Express isotopically labeled protein (15N, 13C, 2H)

    • Collect solution NMR data for isolated domains

    • For full-length protein, consider solid-state NMR

    • Advantages: Provides dynamic information; works in solution

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Expose protein to D2O buffer for varying time periods

    • Quench reaction and digest with pepsin

    • Analyze deuterium incorporation by MS

    • Advantages: Reveals solvent-accessible regions; indicates conformational flexibility

Each technique offers complementary information, and integration of multiple methods provides the most comprehensive structural understanding.

How can mutagenesis approaches be optimized to study Spea_3909 structure-function relationships?

A systematic mutagenesis strategy for Spea_3909 functional analysis should include:

  • Alanine-scanning mutagenesis:

    • Replace consecutive residues with alanine (5-10 residues per construct)

    • Focus on predicted functional motifs and conserved regions

    • Express mutants and assess for:

      • Protein folding/stability via thermal shift assays

      • Membrane localization via fractionation and Western blotting

      • Functional activity in reconstituted systems

    • Identify clusters of functionally important residues

  • Conservative and non-conservative substitutions:

    • For identified key residues, create tailored substitutions:

      • Conservative: Maintain physicochemical properties (D→E, K→R)

      • Non-conservative: Alter properties (D→K, G→P)

    • Evaluate effects on function and binding parameters

  • Domain swapping and chimeric proteins:

    • Identify homologous proteins from related Shewanella species

    • Create chimeric constructs swapping domains

    • Map functional domains and species-specific adaptations

  • Site-directed spin labeling for EPR studies:

    • Introduce cysteine residues at strategic positions

    • Label with spin probes (MTSL)

    • Measure distances between labeled sites

    • Map conformational changes upon substrate binding

This integrated mutagenesis approach provides insights into both structure and mechanistic aspects of Spea_3909 function.

How can Spea_3909 research inform comparative studies of membrane protein evolution in marine bacteria?

Spea_3909 serves as an excellent model for evolutionary studies of membrane proteins in marine bacteria. Researchers should implement these methodological approaches:

  • Phylogenetic analysis across the Shewanellaceae family:

    • Collect homologous sequences from diverse marine environments

    • Align sequences using membrane protein-specific algorithms (TM-Coffee)

    • Construct maximum likelihood phylogenetic trees

    • Calculate selection pressures (dN/dS ratios) across different regions

  • Structural conservation mapping:

    • Identify conservation patterns in transmembrane vs. loop regions

    • Map conservation scores onto predicted structural models

    • Identify environmentally responsive domains showing higher variation

  • Comparative functional assays:

    • Express homologs from bacteria inhabiting different marine niches

    • Compare biochemical properties under varying conditions:

      • Temperature ranges (psychrophilic vs. mesophilic homologs)

      • Salt concentrations (coastal vs. deep-sea homologs)

      • Pressure tolerance (surface vs. deep-sea homologs)

  • Horizontal gene transfer (HGT) analysis:

    • Search for genomic islands containing Spea_3909 homologs

    • Analyze codon usage and GC content signatures

    • Test for incongruence between gene and species trees

These approaches reveal how membrane proteins adapt to marine environments and inform broader understanding of bacterial evolution in changing ocean conditions.

What computational approaches can predict Spea_3909 functional networks in Shewanella pealeana?

To construct reliable functional networks for Spea_3909, integrate these computational approaches:

  • Co-expression network analysis:

    • Analyze transcriptomic data from S. pealeana under various conditions

    • Identify genes with correlated expression patterns

    • Construct weighted gene correlation networks

    • Identify functional modules containing Spea_3909

  • Protein-protein interaction prediction:

    • Use interolog mapping based on known interactions in model organisms

    • Apply structure-based prediction tools (PRISM, HADDOCK)

    • Score predictions based on interface conservation, physicochemical complementarity

    • Generate confidence-weighted interaction networks

  • Genome neighborhood analysis:

    • Examine conservation of genomic context across species

    • Identify consistently co-localized genes suggesting functional relationships

    • Analyze operonic structures and regulatory elements

  • Metabolic network integration:

    • Map Spea_3909 and putative partners onto metabolic networks

    • Identify potential metabolic pathways affected by Spea_3909 function

    • Use flux balance analysis to predict system-level effects

  • Network visualization and analysis:

    • Create multi-layered network representations using Cytoscape

    • Calculate network statistics (betweenness centrality, clustering coefficient)

    • Identify essential nodes and potential compensatory pathways

These integrated computational approaches guide experimental design by generating testable hypotheses about Spea_3909's functional context.

How can researchers develop Spea_3909-specific antibodies for advanced immunological studies?

Development of high-quality antibodies against Spea_3909 requires careful design due to its membrane-embedded nature. Follow this methodological workflow:

  • Epitope selection and antigen design:

    • Analyze Spea_3909 sequence for immunogenic regions:

      • Prioritize extracellular/periplasmic loops (typically more immunogenic)

      • Select regions with high predicted antigenicity and surface accessibility

      • Avoid transmembrane regions prone to non-specific interactions

    • Create multiple antigen formats:

      • Synthetic peptides (15-20 amino acids) from selected regions

      • Recombinant extracellular domains expressed in E. coli

      • Full-length protein in suitable membrane mimetics

  • Immunization and antibody production:

    • Use multiple host species (rabbit, mouse, chicken) for diverse repertoires

    • Implement standard immunization protocol with appropriate adjuvants

    • For monoclonal antibodies, screen hybridomas with ELISA against purified domains

  • Antibody validation methodology:

    • Western blot against native and recombinant protein

    • Immunoprecipitation from membrane fractions

    • Immunofluorescence microscopy in S. pealeana

    • Binding kinetics determination via surface plasmon resonance

    • Knockout/knockdown controls to confirm specificity

  • Application-specific optimization:

    • For co-immunoprecipitation: Optimize detergent conditions

    • For immunolocalization: Test fixation methods compatible with membrane preservation

    • For FRET/FLIM: Consider site-specific labeling approaches

These antibodies serve as valuable tools for studying Spea_3909 localization, interactions, and dynamics within its native cellular context.

How can multi-omics approaches be combined to comprehensively characterize Spea_3909's biological role?

An integrated multi-omics strategy provides the most comprehensive understanding of Spea_3909 function. Implement these methodological approaches:

  • Genomic analysis:

    • Compare syntenic regions across Shewanella species

    • Identify coevolved gene clusters suggesting functional relationships

    • Analyze promoter regions for regulatory elements

  • Transcriptomic profiling:

    • Perform RNA-seq under varying environmental conditions

    • Identify conditions triggering Spea_3909 expression changes

    • Map co-expressed genes for pathway integration

  • Proteomic analysis:

    • Quantify protein abundance changes using MS-based proteomics

    • Perform protein turnover studies using pulse-chase labeling

    • Identify post-translational modifications affecting function

  • Metabolomic integration:

    • Connect Spea_3909 activity to metabolite profiles

    • Identify metabolic signatures in knockout vs. wild-type strains

    • Correlate metabolite changes with protein function

  • Systems biology modeling:

    • Develop mathematical models of Spea_3909-containing pathways

    • Simulate system behavior under varying environmental parameters

    • Generate testable predictions for experimental validation

This multi-layered approach provides unprecedented insight into Spea_3909's role in S. pealeana's adaptation to marine environments and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.