Recombinant Shewanella piezotolerans Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Biological Function and Role in Electron Transport

RnfE is integral to the Rnf complex, which facilitates electron transport across microbial membranes. In Shewanella piezotolerans, this system supports adaptation to extreme environments, including cold temperatures and high pressure .

Key Functional Insights

  • Electron Transfer: RnfE participates in proton (H⁺) or sodium (Na⁺) translocation coupled with NADH:ferredoxin oxidoreductase activity .

  • Redundancy in DMSO Reduction: Studies on Shewanella DMSO reductases reveal functional overlaps, suggesting RnfE may interact with cytochromes like CymA to transfer electrons .

  • Cold Adaptation: S. piezotolerans employs RnfE as part of low-temperature survival strategies, with gene expression vectors (e.g., pSW2) enhancing protein production at 4°C .

Research Uses

  • ELISA Kits: Utilized in immunoassays to detect RnfE-specific antibodies or protein interactions .

  • Protein Expression: Studied in cold-inducible systems (e.g., pSW2 vector) to optimize production under psychrotolerant conditions .

  • Genomic Analysis: Linked to S. piezotolerans’ genomic adaptation, including flagellar systems and osmolyte transport .

Comparative Analysis with Other RnfE Homologs

RnfE from S. piezotolerans shares structural and functional similarities with homologs in other bacteria, though its expression and regulation are adapted to deep-sea environments.

OrganismUniprot IDExpression HostPurityKey RoleSource
Shewanella piezotoleransB8CM53Baculovirus/E. coli>85%Low-temperature electron transport
Shewanella oneidensisN/ACell-free expression>85%Metal ion reduction
Pseudomonas stutzeriN/ACell-free expression>85%General electron transport

Research Challenges and Future Directions

  • Stability: Repeated freezing/thawing degrades RnfE, necessitating aliquoting and low-temperature storage .

  • Functional Redundancy: Overlapping roles with other electron transport proteins (e.g., DmsE, CctA) complicate mechanistic studies .

  • Biotechnological Potential: RnfE’s cold-adapted properties may enable applications in bioremediation or cold-active enzyme production .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note: The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rnfE; swp_2365; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Shewanella piezotolerans (strain WP3 / JCM 13877)
Target Names
swp_2365
Target Protein Sequence
MSDYKELAWQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATMLVLIGSNILVSLVR DYVPKEIRIPVFVMIIAALVTSVQLFINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFAS RNSVVKSTFDGLMMGLGFTLVLCVLGASREILGQGTLFYGADQLLGEWAKGLTIQIWQVD TTFLLAMLPPGAFIGMGLLIALKNVIDNYIEARQPKVELEAPARVRITKVN
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella piezotolerans and why is it significant for research?

Shewanella piezotolerans WP3 is a gram-negative, facultative anaerobic gammaproteobacterium isolated from west Pacific deep-sea sediment at a depth of 1914 m. It is significant because it demonstrates remarkable adaptability to extreme environments, growing in pressure ranges of 0.1–50 MPa (with optimal growth at 20 MPa) and temperatures between 0–28°C (with optimum growth at 20°C) . This bacterium belongs to the Shewanella genus, which is renowned for versatile respiratory capabilities and the ability to use diverse compounds as terminal electron acceptors, including iron, manganese, sulfite, oxygen, chromium, uranium, nitrate, fumarate, and others . The adaptability of S. piezotolerans to harsh deep-sea conditions makes it an excellent model organism for studying microbial adaptation mechanisms to extreme environments .

What is the RnfE protein and what role does it play in S. piezotolerans?

The RnfE protein (encoded by the rnfE gene) is a component of the electron transport complex in Shewanella piezotolerans. It functions as an ion-translocating oxidoreductase complex subunit, participating in the Rnf electron transport system . The full-length protein consists of 231 amino acids and contains transmembrane domains characteristic of membrane-associated electron transport proteins . The RnfE protein is part of a larger system that enables S. piezotolerans to utilize various electron acceptors, contributing to its metabolic versatility in deep-sea environments where electron acceptor availability may fluctuate. This capability is crucial for the bacterium's survival in extreme conditions and underlies its ecological significance in deep-sea ecosystems .

What is the amino acid sequence and structure of S. piezotolerans RnfE?

The full-length S. piezotolerans RnfE protein consists of 231 amino acids. The complete amino acid sequence is:

MSDYKELAWQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGLATMLVLIGSNILVSLVRDYVPKEIRIPVFVMIIAALVTSVQLFINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFASRNSVVKSTFDGLMMGLGFTLVLCVLGASREILGQGTLFYGADQLLGEWAKGLTIQIWQVDTTFLLAMLPPGAFIGMGLLIALKNVIDNYIEARQPKVELEAPARVRITKVN

Structurally, RnfE is a membrane-associated protein with multiple transmembrane domains that anchor it within the cell membrane. Its structure facilitates electron transport across the membrane, which is essential for the bacterium's energy metabolism. The protein contains hydrophobic regions consistent with membrane integration and functional domains involved in electron transfer and possibly proton/ion translocation . While detailed three-dimensional structural analyses are still limited, the primary sequence suggests functional similarities to other electron transport proteins in related bacterial species.

How does recombinant RnfE protein differ from native RnfE?

Recombinant S. piezotolerans RnfE protein is typically produced with modifications to facilitate purification and characterization. The commercially available recombinant protein is expressed in E. coli with an N-terminal His-tag . This tag introduces several key differences compared to the native protein:

  • The His-tag fusion adds approximately 6-10 histidine residues to the N-terminus, which facilitates protein purification through metal affinity chromatography.

  • Recombinant RnfE is expressed in E. coli rather than S. piezotolerans, which may result in different post-translational modifications compared to the native protein.

  • The recombinant protein is typically purified and provided as a lyophilized powder in tris/PBS-based buffer with trehalose (pH 8.0), whereas the native protein exists within the membrane environment of S. piezotolerans cells .

  • While the recombinant protein maintains the primary sequence and most likely the secondary structure of native RnfE, its tertiary structure and functional properties may differ slightly due to the expression system and purification process.

These differences should be considered when using recombinant RnfE for research purposes, particularly when studying structure-function relationships or conducting in vitro activity assays.

How does RnfE contribute to S. piezotolerans' adaptation to deep-sea environments?

RnfE plays a significant role in S. piezotolerans' adaptation to deep-sea environments through several mechanisms. As part of the electron transport chain, RnfE contributes to the bacterium's remarkable metabolic flexibility, allowing it to utilize multiple electron acceptors available in variable deep-sea conditions . This adaptability is crucial in environments where oxygen can be limited, and alternative electron acceptors must be used for respiration.

The electron transport capabilities provided by RnfE and related proteins enable S. piezotolerans to perform iron reduction, a significant metabolic process in deep-sea sediments. The genome of S. piezotolerans WP3 contains numerous genes encoding c-type cytochromes (55 open reading frames) and possesses the mtr-omc gene cluster involved in insoluble metal reduction, highlighting the importance of electron transport systems in its environmental adaptation .

The functionality of RnfE under high pressure (piezotolerance) and low temperature (psychrotolerance) conditions demonstrates evolutionary adaptations at the molecular level. These adaptations likely include structural modifications that maintain protein flexibility and function at high pressures, which would normally compress and rigidify proteins, and at low temperatures, which typically reduce molecular motion and reaction rates . The RnfE protein may also interact with other cellular components, such as membrane lipids (particularly eicosapentaenoic acid, which S. piezotolerans can synthesize), to maintain membrane fluidity and functionality under extreme conditions .

What are the regulatory mechanisms controlling rnfE gene expression in S. piezotolerans?

The regulation of rnfE gene expression in S. piezotolerans involves complex mechanisms that respond to environmental conditions, particularly temperature and pressure. Research has identified both transcriptional and post-transcriptional regulatory mechanisms:

Understanding these regulatory mechanisms provides insights into how S. piezotolerans maintains metabolic functionality in extreme environments and could inform studies on bacterial adaptation to deep-sea conditions.

How does RnfE interact with other components of the electron transport chain?

RnfE functions as part of a larger electron transport complex, interacting with several other proteins to facilitate electron transfer. Based on comparative genomic analyses and studies in related species, the following interactions are likely:

  • Interaction with other Rnf complex subunits: RnfE typically interacts with other subunits of the Rnf complex (RnfA, RnfB, RnfC, RnfD, and RnfG) to form a functional electron transport unit. These interactions create a membrane-bound complex capable of coupling electron transfer to ion translocation across the membrane.

  • Interactions with c-type cytochromes: S. piezotolerans WP3 contains 55 open reading frames encoding putative c-type cytochromes . These cytochromes likely interact with the Rnf complex, including RnfE, to facilitate electron transfer to various terminal electron acceptors.

  • Connection to the mtr-omc pathway: The mtr-omc gene cluster is involved in insoluble metal reduction in Shewanella species . RnfE may interact with components of this pathway, directly or indirectly, contributing to the bacterium's ability to reduce metals like iron in deep-sea environments.

  • Membrane integration and lipid interactions: As a membrane protein, RnfE interacts with membrane lipids, including potentially specialized lipids like eicosapentaenoic acid (EPA), which S. piezotolerans can synthesize . These interactions are crucial for maintaining protein function under extreme conditions of pressure and temperature.

The specific stoichiometry and molecular details of these interactions in S. piezotolerans remain areas of active research, particularly in the context of how these interactions are maintained under extreme environmental conditions.

What structural adaptations enable RnfE to function under high pressure and low temperature?

RnfE from S. piezotolerans exhibits several structural adaptations that enable function under the extreme conditions of high pressure and low temperature found in deep-sea environments:

The genome of S. piezotolerans WP3 contains numerous genes for structural RNA modification, which may also contribute to maintaining protein synthesis machinery function under extreme conditions, ensuring proper production of proteins like RnfE . Understanding these adaptations provides insights into the molecular basis of piezotolerance and psychrotolerance in deep-sea bacteria.

What are the optimal conditions for recombinant S. piezotolerans RnfE protein expression and purification?

For optimal expression and purification of recombinant S. piezotolerans RnfE, the following protocol is recommended based on established methodologies:

Expression System and Conditions:

  • Host: E. coli BL21(DE3) or similar expression strains

  • Vector: pET-series vectors containing an N-terminal His-tag

  • Culture conditions:

    • Temperature: 16-18°C after induction (to prevent inclusion body formation)

    • Induction: 0.1-0.5 mM IPTG when OD600 reaches 0.6-0.8

    • Duration: 16-20 hours post-induction

    • Media: LB or 2xYT supplemented with appropriate antibiotics

Purification Protocol:

  • Cell lysis:

    • Resuspend cells in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, and protease inhibitor cocktail)

    • Lyse cells by sonication or pressure-based homogenization

    • Centrifuge at 20,000 × g for 30 minutes at 4°C to separate membrane fraction

  • Membrane protein extraction:

    • Solubilize membrane fraction with detergent buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 1% n-dodecyl-β-D-maltoside or similar mild detergent)

    • Incubate with gentle rotation at 4°C for 1-2 hours

    • Centrifuge at 100,000 × g for 1 hour to remove insoluble material

  • Affinity purification:

    • Apply solubilized protein to Ni-NTA resin

    • Wash with buffer containing 20-40 mM imidazole

    • Elute with buffer containing 250-300 mM imidazole

  • Further purification:

    • Size exclusion chromatography using Superdex 200 column

    • Buffer exchange to final storage buffer (Tris/PBS-based buffer, pH 8.0 with 6% trehalose)

  • Storage:

    • Lyophilize or store at -80°C in aliquots

    • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for long-term storage at -20°C/-80°C

This protocol typically yields protein with >90% purity as determined by SDS-PAGE . The purified protein should be aliquoted to avoid repeated freeze-thaw cycles, which can compromise protein integrity.

What techniques are used to study RnfE function in vitro?

Several sophisticated techniques can be employed to study the function of recombinant S. piezotolerans RnfE in vitro:

  • Electron transfer assays:

    • Spectrophotometric assays using artificial electron donors (like NADH) and acceptors (like ferricyanide)

    • Oxygen consumption measurements using Clark-type electrodes

    • Cyclic voltammetry to characterize redox properties

  • Reconstitution into liposomes:

    • Incorporation of purified RnfE into liposomes to study membrane transport function

    • Ion flux measurements using fluorescent probes or radioactive tracers

    • Membrane potential measurements using potential-sensitive dyes

  • Structural characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Fourier-transform infrared spectroscopy (FTIR) for membrane protein structure

    • Cryo-electron microscopy for higher-resolution structural studies

    • X-ray crystallography (challenging for membrane proteins but potentially informative)

  • Pressure and temperature dependence studies:

    • High-pressure spectroscopy to examine functional changes under pressure

    • Temperature-dependent activity assays to determine optimal functioning conditions

    • Differential scanning calorimetry to assess thermal stability

    • High-pressure stopped-flow kinetics to measure reaction rates under pressure

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged RnfE as bait

    • Surface plasmon resonance to measure interaction kinetics

    • Cross-linking followed by mass spectrometry to identify interaction partners

    • Fluorescence resonance energy transfer (FRET) to study dynamic interactions

  • Lipid interaction studies:

    • Lipid binding assays to determine interactions with specific lipids

    • Reconstitution into nanodiscs with defined lipid composition

    • Microscale thermophoresis to measure binding affinities

These methodologies provide complementary information about RnfE function, from basic biochemical properties to complex interactions with other cellular components. When studying a piezotolerant protein like RnfE, it's particularly important to consider how conditions of pressure and temperature affect the results of these assays.

How can researchers study the effects of pressure and temperature on RnfE activity?

Studying the effects of pressure and temperature on RnfE activity requires specialized equipment and methodologies designed to simulate deep-sea conditions:

Pressure-Dependent Studies:

  • High-pressure bioreactors:

    • Custom pressure vessels allowing cultivation of S. piezotolerans at various pressures (0.1-50 MPa)

    • Pressure vessels used in previous studies include pin closure pressure vessels (Feiyu Petrochemical Instrument Equipment Inc.)

    • Cells can be grown in anaerobic conditions at atmospheric pressure, then transferred to sterile injection syringes placed inside pressure vessels for high-pressure incubation

  • High-pressure enzymatic assays:

    • Specialized high-pressure optical cells for spectrophotometric measurements

    • High-pressure stopped-flow apparatus for kinetic measurements

    • Diamond anvil cells coupled with spectroscopic techniques for extreme pressure studies

  • Pressure effects on protein structure:

    • High-pressure NMR spectroscopy

    • High-pressure FTIR or CD spectroscopy

    • Small-angle X-ray scattering under pressure

Temperature-Dependent Studies:

  • Low-temperature cultivation:

    • Growth of S. piezotolerans at various temperatures (0-28°C)

    • Comparison of gene expression and protein levels at different temperatures

    • Anaerobic cultivation at low temperatures (e.g., 4°C) compared to optimal temperature (20°C)

  • Temperature-dependent enzyme kinetics:

    • Measurement of RnfE activity across temperature range

    • Determination of activation energies and thermodynamic parameters

    • Assessment of cold adaptation mechanisms

Combined Approaches:

  • Matrix experimental design:

    • Factorial design combining various pressures and temperatures

    • Analysis of interaction effects between pressure and temperature

    • Determination of optimal and limiting conditions

  • In situ vs. ex situ measurements:

    • Comparison of activity in whole cells vs. purified systems

    • Analysis of integrated system responses vs. isolated protein behavior

  • Multi-omics integration:

    • Correlation of RnfE activity with transcriptomic data from cells grown at different conditions

    • Integration of proteomic and metabolomic data to understand system-level responses

By applying these methodologies, researchers can gain insights into how RnfE has adapted to function in the deep-sea environment and how pressure and temperature affect its activity, stability, and interactions with other cellular components.

What approaches are used to study rnfE gene regulation in S. piezotolerans?

Studying rnfE gene regulation in S. piezotolerans involves several complementary molecular and systems biology approaches:

  • Transcriptomic analysis:

    • RNA sequencing (RNA-seq) to quantify rnfE expression under different environmental conditions

    • Differential expression analysis comparing various temperatures, pressures, and growth conditions

    • Time-course experiments to capture dynamic regulation

  • Quantitative PCR techniques:

    • Reverse transcription quantitative PCR (RT-qPCR) for targeted quantification of rnfE transcript levels

    • Similar techniques have been successfully employed to verify expression of genes in S. piezotolerans under different conditions

  • Small RNA identification and characterization:

    • Computational approaches for sRNA prediction, as demonstrated in previous studies identifying 209 sRNA candidates in S. piezotolerans WP3

    • Northern blotting or specialized RNA-seq to validate and quantify sRNAs

    • Target prediction algorithms to identify potential regulatory interactions between sRNAs and rnfE

  • Promoter analysis:

    • 5' RACE (Rapid Amplification of cDNA Ends) to identify transcription start sites

    • Reporter gene assays using promoter-reporter fusions

    • DNA footprinting to identify protein binding sites in the promoter region

  • Chromatin immunoprecipitation (ChIP):

    • ChIP-seq to identify transcription factors binding to the rnfE promoter

    • Analysis of histone-like proteins and their role in gene regulation

  • Genetic manipulation:

    • Construction of knockout or knockdown strains to identify regulatory factors

    • Complementation studies to verify regulatory relationships

    • CRISPR-Cas9 approaches for precise genetic manipulation

  • Environmental stimulation experiments:

    • Growth under various conditions (temperature, pressure, electron acceptors)

    • Monitoring gene expression changes in response to environmental shifts

    • Time-resolved studies to capture regulatory dynamics

  • Multi-omics integration:

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Network analysis to identify regulatory hubs and connections

    • Comparative analysis with other Shewanella species to identify conserved regulatory mechanisms

Previous studies with S. piezotolerans have successfully used approaches like qPCR to verify expression of genes under different conditions, such as the induction of phage genes at low temperature . Similar approaches can be applied to study rnfE regulation, potentially revealing how this gene responds to the extreme conditions of the deep-sea environment.

Data Analysis and Experimental Applications

Several experimental systems can be employed to study RnfE function in vivo, each with specific advantages for addressing different research questions:

Native S. piezotolerans System:

  • Wild-type and knockout comparisons:

    • Generation of rnfE knockout strains in S. piezotolerans WP3

    • Phenotypic characterization under various conditions (pressure, temperature, electron acceptors)

    • Complementation studies with wild-type or mutant rnfE genes

  • High-pressure cultivation systems:

    • Custom pressure vessels allowing cultivation at various pressures (0.1-50 MPa)

    • Pin closure pressure vessels have been successfully used for S. piezotolerans cultivation

    • Systems that allow sampling or monitoring without depressurization

  • In situ electron transport measurements:

    • Whole-cell electrochemistry

    • Respirometry under various conditions

    • Metal reduction assays measuring conversion of iron or manganese

Heterologous Expression Systems:

  • Expression in model organisms:

    • S. oneidensis MR-1 as a well-characterized Shewanella host

    • E. coli expression systems for comparative studies

    • Complementation of rnf-deficient strains with S. piezotolerans rnfE

  • Synthetic biology approaches:

    • Minimal electron transport chains reconstituted in heterologous hosts

    • Modular systems to test specific interactions

    • Reporter systems coupled to electron transport activity

Advanced Imaging and Analytical Techniques:

  • Fluorescent protein fusions:

    • RnfE-GFP fusions to track localization

    • FRET-based systems to monitor protein-protein interactions

    • Split-GFP complementation to verify complex formation

  • Metabolic analysis:

    • Isotope labeling to track electron flow

    • Metabolomics to identify pathway bottlenecks

    • Flux balance analysis to model system behavior

Advantages and Limitations:

Experimental SystemKey AdvantagesMajor LimitationsBest Applications
Native S. piezotoleransMost physiologically relevant; True environmental responsesChallenging to cultivate; Limited genetic toolsEnvironmental adaptation studies; Natural function assessment
S. oneidensis heterologousWell-established genetic tools; Extensive prior knowledgeDifferent native environment; May lack cofactorsComponent interactions; Comparative function
E. coli heterologousSimplest genetic manipulation; Highest yieldMost distant from native environmentProtein production; Basic biochemical characterization
Advanced imaging systemsReal-time visualization; Spatial informationMay affect protein function; Technical complexityLocalization studies; Dynamic interactions

The choice of experimental system should be guided by the specific research questions being addressed. For fundamental studies of RnfE's role in environmental adaptation, the native S. piezotolerans system is preferred despite its technical challenges. For detailed mechanistic studies, a combination of approaches often provides the most comprehensive insights.

How can researchers apply knowledge about RnfE to broader studies of bacterial adaptation to extreme environments?

Research on S. piezotolerans RnfE contributes valuable insights to the broader understanding of bacterial adaptation to extreme environments in several ways:

  • Model system for piezoadaptation:

    • RnfE serves as a model membrane protein for studying molecular adaptations to high pressure

    • Comparative studies between RnfE from piezotolerant and non-piezotolerant organisms can reveal specific adaptations

    • Identification of pressure-resistant structural motifs could inform predictions about other proteins' pressure sensitivity

  • Applications in synthetic biology:

    • Engineering pressure-resistant electron transport systems for biotechnology applications

    • Development of biosensors that function under extreme conditions

    • Design of bioremediation systems for deep-sea environments, building on S. piezotolerans' demonstrated abilities in metal reduction

  • Astrobiology implications:

    • Insights into potential life in extreme environments on Earth and potentially other planetary bodies

    • Understanding limits of biological electron transport under extreme conditions

    • Models for evolution of metabolic systems under selective pressure

  • Methodological advances:

    • Development of high-pressure protein expression and analysis techniques

    • Approaches for studying membrane protein function under extreme conditions

    • Integration of multi-omics data to understand system-level responses to environmental stressors

  • Ecological understanding:

    • Better models of biogeochemical cycling in deep-sea environments

    • Understanding bacterial contributions to deep-sea ecosystem functioning

    • Insights into microbial community adaptation and evolution in extreme habitats

  • Climate change relevance:

    • Understanding adaptations to temperature changes in key bacterial species

    • Potential impacts of changing ocean conditions on deep-sea bacterial metabolism

    • Models for predicting microbial responses to environmental perturbations

  • Comparative genomics framework:

    • The phylogenetic analysis of S. piezotolerans and related species provides a framework for understanding the evolution of extreme environment adaptations

    • Identification of gene clusters and pathways specifically associated with deep-sea adaptation

    • Models for convergent and divergent evolution under similar selective pressures

By studying specific systems like RnfE in detail, researchers gain both specific insights into this protein's function and broader understanding of how cellular systems adapt to extreme conditions. This knowledge has implications ranging from fundamental evolutionary biology to applied biotechnology and environmental science.

What are the key challenges in isolating and characterizing membrane proteins like RnfE from extremophiles?

Working with membrane proteins from extremophiles like S. piezotolerans presents several unique challenges that researchers must overcome:

  • Structural integrity maintenance:

    • Membrane proteins often denature or aggregate when removed from their native lipid environment

    • Extremophile proteins may have specialized structural features that are particularly sensitive to environmental changes

    • Maintaining the native conformation of RnfE during extraction and purification requires careful optimization of detergents and buffer conditions

  • Cultivation challenges:

    • Growing piezotolerant organisms like S. piezotolerans requires specialized equipment to maintain appropriate pressure conditions

    • Achieving sufficient biomass for protein purification is difficult due to slower growth rates under extreme conditions

    • Balancing authentic environmental conditions with practical laboratory constraints presents ongoing challenges

  • Functional assay development:

    • Assessing function under high pressure requires specialized equipment not commonly available in biochemistry laboratories

    • Reconstituting electron transport chains in vitro is complex due to multiple components and cofactors

    • Distinguishing functional changes due to pressure/temperature from artifacts of the experimental system

  • Structural analysis limitations:

    • Membrane proteins are notoriously difficult to crystallize for X-ray crystallography

    • High-resolution structural techniques like cryo-EM face additional challenges with smaller membrane proteins like RnfE

    • NMR studies require specialized high-pressure equipment for studying proteins under native-like conditions

  • Expression system compatibility:

    • Heterologous expression of extremophile proteins in mesophilic hosts often results in misfolding or aggregation

    • Codon usage differences between extremophiles and expression hosts can limit protein production

    • Post-translational modifications may differ between native and expression systems

Innovative Solutions:

ChallengeTraditional ApproachInnovative SolutionAdvantages
Maintaining native structureDetergent solubilizationNanodiscs or SMALPs (styrene-maleic acid lipid particles)Preserves native lipid environment; Better stability
Low-yield cultivationLarge-volume culturesContinuous culture bioreactors with pressure controlSustained biomass production; More authentic conditions
Functional characterizationIn vitro biochemical assaysWhole-cell electrochemistry; In vivo imagingMaintains cellular context; Real-time measurements
Structural analysisCrystallography attemptsIntegrative structural biology combining multiple techniquesComplementary data; Works with challenging proteins
Expression challengesE. coli expressionCell-free expression systems; Native host expressionAvoids folding issues; More authentic modifications

These challenges highlight why membrane proteins from extremophiles remain understudied despite their importance in understanding adaptation to extreme environments. Continued methodological innovations are essential for advancing this field and gaining deeper insights into proteins like RnfE.

What are the future research directions for S. piezotolerans RnfE studies?

Research on S. piezotolerans RnfE has opened numerous promising avenues for future investigation, spanning from fundamental molecular mechanisms to applied biotechnological applications. Key future directions include:

  • Structural biology advancements:

    • Determination of high-resolution structures of RnfE under various pressure and temperature conditions

    • Structural comparisons with homologs from non-piezotolerant Shewanella species to identify specific adaptations

    • Investigation of conformational changes during electron transport using time-resolved structural techniques

  • Systems-level integration:

    • Comprehensive characterization of the entire Rnf complex and its interactions with other components of S. piezotolerans' electron transport system

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics to understand system-level responses to environmental changes

    • Modeling of electron flow through RnfE under various environmental conditions

  • Regulatory network mapping:

    • Detailed characterization of sRNA-mediated regulation of rnfE expression under various environmental conditions

    • Identification of transcription factors controlling rnfE expression

    • Construction of comprehensive regulatory networks governing electron transport in response to pressure and temperature

  • Evolutionary adaptations:

    • Comparative analysis across a broader range of deep-sea bacteria to identify convergent evolutionary adaptations

    • Experimental evolution studies under controlled pressure and temperature conditions

    • Ancestral sequence reconstruction to trace the evolution of piezotolerance in electron transport proteins

  • Biotechnological applications:

    • Development of RnfE-based biosensors for extreme environments

    • Engineering of pressure-resistant electron transport systems for biotechnology applications

    • Exploration of S. piezotolerans and its RnfE complex for bioremediation of metal-contaminated environments, building on observed chromate reduction capabilities in related Shewanella species

  • Methodological advances:

    • Development of improved techniques for membrane protein expression and characterization under high pressure

    • Creation of genetic tools specifically designed for manipulation of piezotolerant organisms

    • Establishment of standardized protocols for studying protein function under extreme conditions

These future directions will not only advance our understanding of S. piezotolerans RnfE specifically but also contribute to broader knowledge about bacterial adaptation to extreme environments and the evolution of electron transport systems under selective pressure. The continuing integration of advanced technologies from structural biology, systems biology, and synthetic biology promises to accelerate progress in this fascinating field.

How does research on RnfE contribute to our understanding of life in extreme environments?

Research on RnfE from S. piezotolerans makes significant contributions to our understanding of life in extreme environments through several important mechanisms:

  • Molecular basis of piezotolerance:

    • RnfE provides a concrete example of how membrane proteins adapt to function under high pressure

    • Studies of RnfE structure and function reveal specific adaptations that maintain protein flexibility and activity under conditions that would normally rigidify proteins

    • The integration of RnfE within membrane systems demonstrates how entire cellular processes adapt to extreme conditions

  • Energy metabolism in extreme environments:

    • RnfE's role in electron transport illustrates how fundamental energy generation processes are maintained under extreme conditions

    • The versatility of S. piezotolerans' electron transport system, including RnfE, explains how organisms can thrive in environments with variable electron acceptor availability

    • Understanding these processes helps explain biogeochemical cycling in deep-sea ecosystems

  • Evolutionary insights:

    • Comparative genomic analysis including RnfE and related proteins has revealed that S. piezotolerans WP3 and S. pealeana PV-4 are closely related, suggesting evolutionary pathways for adaptation to deep-sea environments

    • The presence of specialized gene clusters in piezotolerant bacteria demonstrates how selective pressure shapes genomes

    • The study of RnfE contributes to our understanding of convergent and divergent evolution under extreme conditions

  • Limits of life:

    • Research on proteins like RnfE helps define the environmental boundaries where biological processes can function

    • Understanding these limits informs theories about the potential for life in other extreme environments on Earth and beyond

    • The adaptability of fundamental processes like electron transport suggests that life may exist in an even wider range of environments than previously thought

  • Adaptation mechanisms:

    • The regulatory systems controlling rnfE expression, including sRNAs that respond to low temperature, illustrate how organisms sense and adapt to environmental changes

    • These mechanisms provide insights into short-term acclimation as well as long-term evolutionary adaptation

    • Understanding such processes helps predict how microorganisms might respond to changing environmental conditions

By investigating specific proteins like RnfE in detail while placing them within their broader cellular and ecological context, researchers gain valuable insights into the fundamental principles governing life in extreme environments. This research not only advances basic science but also has implications for biotechnology, astrobiology, and our understanding of Earth's diverse ecosystems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.