Recombinant Shewanella piezotolerans Probable intracellular septation protein A (swp_1903)

What is Shewanella piezotolerans Probable intracellular septation protein A (swp_1903)?

Swp_1903 is a 181-amino acid protein from the piezotolerant (pressure-tolerant) marine bacterium Shewanella piezotolerans strain WP3/JCM 13877. It is classified as a probable intracellular septation protein based on sequence homology with known septation proteins in other bacterial species. The protein has a molecular weight of approximately 21 kDa and is characterized by high hydrophobicity, suggesting it may be membrane-associated. Swp_1903 is likely involved in bacterial cell division processes, particularly in the formation of the septum during binary fission under varying pressure conditions. The protein contains multiple transmembrane domains that facilitate its integration into bacterial membranes where it performs its cellular functions .

What is the amino acid sequence of swp_1903?

The complete amino acid sequence of swp_1903 consists of 181 residues: MKQLLDFIPLVIFFAVYKFFDIYIASGALIAATALQLIISYMLYKKLEKMLITFAMVSVFGSLTLILHDDSFKWKVTIVYALFAIALAVSFQMNKPILKSMLGKELVVEDKIWAHVTWYWVLFFVVCGLVNIYVAFSLSQETWVNFKVFGLTALTLINTVLTVFYLFKNMSEEDKKELK. This sequence reveals several hydrophobic regions that likely form transmembrane domains, consistent with its predicted function as a membrane protein involved in septation processes. Researchers studying this protein should note the high proportion of hydrophobic amino acids, which significantly influences experimental approaches for expression, purification, and structural analysis .

What structural characteristics define swp_1903?

Swp_1903 exhibits structural features typical of membrane-associated septation proteins. Computational analysis predicts multiple transmembrane helices that anchor the protein within the bacterial membrane. The hydrophobic profile analysis indicates several membrane-spanning domains interspersed with short hydrophilic regions that likely project into either the cytoplasm or periplasm. The protein's membrane topology is critical for its function in septum formation during cell division. Homology modeling based on related septation proteins suggests a structure where transmembrane domains create a scaffold that facilitates proper septum assembly at the division site. These structural characteristics are consistent with other bacterial septation proteins that coordinate the spatial and temporal aspects of cell division .

How is recombinant swp_1903 typically produced?

Recombinant swp_1903 is typically produced using E. coli expression systems. The process involves:

• Gene synthesis or PCR amplification of the swp_1903 gene from Shewanella piezotolerans genomic DNA

• Cloning into an appropriate expression vector (typically with a His-tag for purification)

• Transformation into an E. coli expression strain optimized for membrane protein production

• Induction of protein expression under controlled conditions (temperature, IPTG concentration, duration)

• Cell lysis and membrane fraction isolation

• Solubilization of membrane proteins using appropriate detergents

• Affinity purification using the His-tag

• Optional further purification steps such as size exclusion chromatography

Due to its hydrophobic nature, expression optimization often involves testing different E. coli strains, induction conditions, and detergents to maximize yield while maintaining protein functionality .

How does swp_1903 function compare to homologous septation proteins?

Based on homology with the ispA protein in Shigella flexneri, swp_1903 likely plays a crucial role in bacterial cell division. The ispA protein in S. flexneri has been shown to be essential for proper septum formation during cell division, with mutations leading to filamentous bacteria lacking septa. Additionally, ispA affects actin polymerization necessary for bacterial spreading between host cells.

In comparison, swp_1903 from S. piezotolerans likely serves similar septation functions but with adaptations for high-pressure environments. While both proteins are small (approximately 21 kDa) and highly hydrophobic, swp_1903 may contain specific structural modifications that maintain functionality under elevated pressures. Comparative functional analysis would require complementation studies, where swp_1903 is expressed in ispA-deficient S. flexneri or E. coli strains to assess functional conservation. Such studies would involve microscopic examination of cell morphology, septum formation, and division rates under varying pressure conditions to determine the degree of functional homology .

What experimental challenges arise when working with swp_1903?

Researchers working with swp_1903 face several experimental challenges due to its properties as a hydrophobic membrane protein:

• Expression difficulties: The hydrophobic nature of swp_1903 often leads to toxicity in expression hosts, protein aggregation, and inclusion body formation. Researchers must optimize expression conditions by testing various E. coli strains, induction temperatures (typically lower temperatures of 16-20°C), and inducer concentrations.

• Solubilization challenges: Extracting functional swp_1903 from membranes requires careful selection of detergents that maintain protein structure and function. Screening multiple detergents (such as DDM, LDAO, or CHAPS) is often necessary to identify optimal solubilization conditions.

• Purification obstacles: Even with affinity tags, purification can be complicated by detergent micelles, non-specific hydrophobic interactions, and potential oligomerization. Multi-step purification strategies combining affinity chromatography with size exclusion and ion exchange methods may be required.

• Stability issues: Once purified, membrane proteins like swp_1903 often exhibit limited stability in solution. Buffer optimization with specific lipids or lipid-like molecules may be necessary to maintain protein stability during experimentation .

What methods are effective for studying swp_1903 interaction partners?

To identify and characterize swp_1903 interaction partners, researchers can employ several complementary approaches:

• Co-immunoprecipitation (Co-IP): Using antibodies against tagged swp_1903 to pull down protein complexes from bacterial lysates, followed by mass spectrometry to identify interacting proteins. This approach works best with optimized detergent conditions that preserve protein-protein interactions.

• Bacterial two-hybrid assays: By creating fusion proteins with swp_1903 and potential partners linked to separated domains of a transcription factor, interactions can be detected through reporter gene activation. This system is particularly useful for screening a library of potential interactors.

• Proximity labeling approaches: Methods like BioID or APEX, where swp_1903 is fused to a biotin ligase or peroxidase that biotinylates nearby proteins, allowing subsequent purification and identification of proximal proteins in the native cellular environment.

• Crosslinking mass spectrometry: Chemical crosslinking of proteins in intact cells followed by tandem mass spectrometry can capture both stable and transient interactions in the native cellular context.

• Fluorescence microscopy with co-localization analysis: Using fluorescently tagged swp_1903 and potential partners to observe their spatial relationship during different cell cycle stages.

Each method has strengths and limitations, so a combination of approaches provides the most comprehensive understanding of swp_1903's interaction network .

How can researchers optimize swp_1903 expression and purification?

Optimizing expression and purification of swp_1903 requires a systematic approach:

• Expression optimization:

  • Test multiple E. coli strains (C41(DE3), C43(DE3), or Lemo21(DE3)) specifically designed for membrane protein expression

  • Evaluate different expression vectors with varying promoter strengths and fusion tags

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Consider auto-induction media for gradual protein production

  • Supplement growth media with specific lipids that may stabilize the expressed protein

• Purification strategy:

  • Screen detergent panel (DDM, LDAO, CHAPS, Triton X-100) for efficient solubilization

  • Implement two-step purification with immobilized metal affinity chromatography followed by size exclusion chromatography

  • Consider the addition of lipids or lipid-like molecules to maintain protein stability

  • Utilize fluorescence-based thermal stability assays to identify optimal buffer conditions

  • Consider nanodiscs or amphipols for transferring purified protein into a more native-like membrane environment

• Quality assessment:

  • Verify protein identity by mass spectrometry

  • Assess homogeneity by dynamic light scattering

  • Evaluate secondary structure using circular dichroism

  • Confirm proper folding using tryptophan fluorescence spectroscopy

This systematic approach increases the likelihood of obtaining functional recombinant swp_1903 suitable for downstream structural and functional studies .

How might swp_1903 contribute to piezotolerance in Shewanella piezotolerans?

The function of swp_1903 in piezotolerance likely involves maintaining proper cell division under high-pressure conditions. Several mechanisms may explain this contribution:

• Membrane fluidity regulation: High pressure typically increases membrane rigidity, potentially disrupting normal septation processes. Swp_1903 may contain specific structural adaptations that maintain proper membrane fluidity and insertion dynamics under pressure, allowing septum formation to proceed normally.

• Pressure-resistant protein-protein interactions: The protein interaction network required for septum formation may be pressure-sensitive. Swp_1903 could have evolved interface regions that maintain critical protein-protein interactions even under elevated pressures.

• Conformational stability under pressure: Many proteins undergo pressure-induced conformational changes that disrupt function. Swp_1903 may have evolved structural elements that resist pressure-induced denaturation or conformational shifts.

• Altered dynamics of septum formation: High pressure affects reaction kinetics. Swp_1903 might facilitate compensatory mechanisms that adjust the rate or order of septum formation events to maintain proper cell division under pressure.

To investigate these hypotheses, researchers should compare the structure and function of swp_1903 with homologous proteins from non-piezotolerant species under varying pressure conditions. Techniques such as high-pressure circular dichroism, fluorescence spectroscopy, and in vitro reconstitution of septation complexes under pressure would provide valuable insights into swp_1903's role in piezotolerance .

What advanced structural biology approaches are suitable for swp_1903 characterization?

Characterizing the structure of hydrophobic membrane proteins like swp_1903 presents significant challenges that require specialized approaches:

• Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology by eliminating the need for crystals. For swp_1903:

  • Reconstitution in nanodiscs or amphipols provides a native-like membrane environment

  • Detergent screening to identify conditions that maintain protein structure

  • Single-particle analysis or subtomogram averaging, depending on protein size and arrangement

• X-ray crystallography adaptations:

  • Lipidic cubic phase (LCP) crystallization, which provides a membrane-mimetic environment

  • Surface engineering through targeted mutations to enhance crystal contacts

  • Fusion with crystallization chaperones like T4 lysozyme or BRIL to provide hydrophilic crystal contacts

• Nuclear magnetic resonance (NMR) spectroscopy:

  • Selective isotope labeling to simplify spectra and focus on specific regions

  • Solid-state NMR approaches for full-length protein in lipid bilayers

  • Solution NMR of individual domains or fragments in detergent micelles

• Integrative structural biology combining:

  • Low-resolution data from small-angle X-ray scattering (SAXS)

  • Distance constraints from electron paramagnetic resonance (EPR) spectroscopy

  • Crosslinking mass spectrometry data

  • Computational modeling to integrate diverse structural data

These advanced approaches, often used in combination, can overcome the challenges inherent in membrane protein structural biology and provide critical insights into swp_1903's structure-function relationships .

How can high-pressure adaptation studies of swp_1903 inform synthetic biology applications?

Studying swp_1903's adaptations for high-pressure environments offers valuable insights for synthetic biology applications:

• Engineering pressure-resistant microorganisms:

  • Identification of pressure-stabilizing motifs in swp_1903 could guide the engineering of other proteins to function under high pressure

  • Creation of synthetic septation systems incorporating swp_1903 elements could enable non-piezotolerant organisms to divide normally under pressure

  • Development of pressure-resistant chassis organisms for bioproduction in high-pressure bioreactors

• Biomaterial development:

  • Understanding how swp_1903 maintains function under pressure could inform the design of pressure-stable biomaterials

  • Pressure-resistant protein domains from swp_1903 could be incorporated into engineered scaffolds for high-pressure applications

• Novel biotechnological processes:

  • Insights from swp_1903 could enable the development of high-pressure enzymatic processes with enhanced efficiency or selectivity

  • Understanding pressure effects on protein-membrane interactions could improve membrane protein expression systems

• Biomedical applications:

  • Knowledge of pressure-stable protein domains could inform the design of therapeutic proteins with enhanced stability under physiological pressure variations

  • Engineering bacteria with controlled septation for specific biomedical applications

Research approaches should include comparative analysis of swp_1903 with homologs from non-piezotolerant organisms, identification of pressure-stabilizing motifs through chimeric protein construction, and functional testing under varying pressure conditions. These studies would establish principles for engineering pressure-tolerant biological systems with diverse applications .

What systems biology approaches would elucidate swp_1903's role in the cell division network?

Understanding swp_1903's position within the broader cell division network requires integrative systems biology approaches:

• Multi-omics integration:

  • Transcriptomics to identify genes co-regulated with swp_1903 under various conditions

  • Proteomics to map protein abundance changes in swp_1903 mutants

  • Metabolomics to detect metabolic shifts resulting from altered cell division

  • Phosphoproteomics to identify signaling pathways connected to swp_1903 function

• Network analysis techniques:

  • Protein-protein interaction mapping through comprehensive pull-down experiments

  • Construction of genetic interaction networks through synthetic genetic arrays

  • Computational prediction of functional associations based on gene neighborhood, fusion events, and co-occurrence patterns

  • Bayesian network modeling to infer causal relationships within the cell division network

• Dynamic system approaches:

  • Time-resolved microscopy to track swp_1903 localization during the cell cycle

  • Fluorescence resonance energy transfer (FRET) sensors to detect protein interactions in real-time

  • Optogenetic tools to perturb swp_1903 function with precise spatial and temporal control

  • Microfluidic single-cell analysis to capture cell-to-cell variability in swp_1903 function

• Comparative systems analysis:

  • Cross-species comparison of septation networks under varying pressure conditions

  • Evolutionary analysis of network rewiring around swp_1903 homologs

These approaches would generate a comprehensive understanding of how swp_1903 integrates into the broader cellular machinery, identifying both conserved functions and species-specific adaptations related to pressure tolerance. The resulting network models would provide testable hypotheses about emergent properties of the cell division system under environmental stress .

What imaging techniques are optimal for studying swp_1903 localization and dynamics?

Investigating the subcellular localization and dynamics of swp_1903 requires specialized imaging approaches:

• Super-resolution microscopy techniques:

  • Structured illumination microscopy (SIM) providing ~100 nm resolution without special fluorophores

  • Stimulated emission depletion (STED) microscopy for resolution down to ~30-50 nm

  • Single-molecule localization microscopy (PALM/STORM) achieving ~20 nm resolution by precisely localizing individual fluorophores

  • Expansion microscopy physically enlarging bacterial cells to increase effective resolution

• Live-cell imaging strategies:

  • Photoactivatable fluorescent protein fusions to track protein movement over time

  • SNAP/CLIP/Halo-tag systems for flexible labeling options with minimal interference

  • Dual-color imaging to correlate swp_1903 dynamics with other divisome components

  • Microfluidic devices to maintain cells under constant conditions while enabling long-term imaging

• High-pressure microscopy adaptations:

  • Specialized pressure chambers compatible with high-resolution objectives

  • Pressure-resistant fluorescent proteins or chemical fluorophores

  • Time-lapse imaging during pressure transitions to capture dynamic responses

• Quantitative analysis approaches:

  • Single-particle tracking to analyze diffusion rates and binding kinetics

  • Fluorescence recovery after photobleaching (FRAP) to measure protein turnover rates

  • Fluorescence correlation spectroscopy to determine concentration and mobility

  • Machine learning algorithms for automated detection of localization patterns

These imaging approaches should be combined with appropriate genetic tools, such as inducible expression systems and fluorescent protein fusions optimized for bacterial expression, to generate a comprehensive spatiotemporal map of swp_1903 behavior under different environmental conditions .

How should researchers design mutation studies to probe swp_1903 function?

Designing effective mutation studies for swp_1903 requires a systematic approach:

• Targeted mutation strategy:

  • Transmembrane domain alterations to assess membrane integration requirements

  • Charged residue modifications at predicted interaction interfaces

  • Conserved motif mutations identified through multiple sequence alignment

  • Chimeric constructs swapping domains with homologs from non-piezotolerant species

  • Introduction of environmentally sensitive probes at strategic positions

• Phenotypic analysis suite:

  • Growth curve analysis under varying pressure conditions

  • Phase-contrast and fluorescence microscopy to assess cell morphology and division defects

  • Membrane integrity assays using fluorescent dyes

  • Live/dead cell discrimination to quantify viability impacts

  • Time-lapse microscopy to measure division dynamics and septum formation

• Molecular characterization approaches:

  • Protein localization studies using fluorescent fusion proteins

  • Co-immunoprecipitation to assess impacts on protein interaction networks

  • Structural analysis of purified mutant proteins

  • In vitro reconstitution assays to test specific functions

  • Pressure tolerance assays to directly measure functional changes

• Complementation analysis:

  • Expression of mutant variants in swp_1903 deletion strains

  • Cross-species complementation with S. flexneri or E. coli homolog mutants

  • Dosage dependency studies with controlled expression levels

  • Competition assays between wild-type and mutant strains

This comprehensive mutation analysis framework would systematically map the structure-function relationships of swp_1903, identifying critical regions for membrane association, protein interactions, and pressure adaptation .

What comparative genomics approaches would illuminate swp_1903 evolution?

Understanding the evolutionary history and adaptations of swp_1903 requires sophisticated comparative genomics approaches:

• Phylogenetic analysis:

  • Construction of comprehensive phylogenetic trees using homologs across bacterial species

  • Reconciliation with species trees to identify duplication, loss, and horizontal transfer events

  • Estimation of selection pressures (dN/dS ratios) across the protein sequence

  • Ancestral sequence reconstruction to trace evolutionary trajectories

• Structural feature mapping:

  • Mapping of conserved and variable regions onto predicted structural models

  • Identification of co-evolving residue networks using statistical coupling analysis

  • Detection of convergent evolution in piezotolerant species from different lineages

  • Correlation of structural features with habitat pressure conditions

• Genomic context analysis:

  • Examination of gene neighborhood conservation across species

  • Identification of co-evolving gene clusters suggesting functional relationships

  • Analysis of regulatory elements to detect environmental response mechanisms

  • Detection of mobile genetic elements that may have facilitated horizontal transfer

• Molecular clock studies:

  • Dating the emergence of key adaptations in piezotolerant lineages

  • Correlation with geological events that created high-pressure habitats

  • Estimation of adaptation rates under varying selection pressures

These comparative approaches would reveal how swp_1903 evolved to function under high pressure, identifying specific adaptations that distinguish it from homologs in non-piezotolerant species. The resulting evolutionary model would provide insights into both the history of bacterial adaptation to deep-sea environments and generalizable principles of protein adaptation to extreme conditions .

How might CRISPR-based approaches advance swp_1903 functional studies?

CRISPR/Cas technologies offer powerful new approaches for studying swp_1903 function:

• Precise genome editing applications:

  • Marker-free deletion or modification of swp_1903 in its native genomic context

  • Introduction of point mutations to test specific functional hypotheses

  • Creation of fluorescent protein fusions at the endogenous locus

  • Insertion of regulatory elements to control native expression

• CRISPRi/CRISPRa approaches:

  • Tunable repression of swp_1903 expression using catalytically dead Cas9 (dCas9) fused to repressors

  • Activation of swp_1903 and related genes using dCas9-activator fusions

  • Multiplexed modulation of septation pathway components to map genetic interactions

  • Temporal control of expression using inducible CRISPR systems

• CRISPR screening applications:

  • Genome-wide screens for synthetic lethal interactions with swp_1903 mutations

  • Targeted screens of cell division genes to identify functional relationships

  • Paired perturbation screens to map genetic interaction networks

  • Environmental screens across pressure conditions to identify condition-specific interactions

• CRISPR-based imaging:

  • CRISPR-based fluorescent tagging for visualization of the endogenous swp_1903 locus

  • Multiplexed imaging of multiple components in the septation machinery

  • Real-time tracking of chromosome segregation relative to swp_1903 activity

Implementing these approaches in S. piezotolerans would require optimization of CRISPR/Cas delivery methods and activity under high-pressure conditions. Comparative studies with homologs in model organisms like E. coli could complement these approaches to build a comprehensive understanding of septation protein function across species .

What high-throughput approaches could accelerate swp_1903 research?

Several high-throughput technologies could significantly accelerate research on swp_1903:

• Library-based screening approaches:

  • Deep mutational scanning to comprehensively map sequence-function relationships

  • Domain-insertion profiling to identify permissive sites for probe insertion

  • Synthetic genetic array analysis to systematically map genetic interactions

  • Chemical-genetic profiling to identify small molecule modulators of swp_1903 function

• Advanced -omics technologies:

  • Ribosome profiling to measure translation efficiency under pressure stress

  • ChIP-seq to map regulatory networks controlling swp_1903 expression

  • RNA-seq under varying pressure conditions to identify co-regulated genes

  • Thermal proteome profiling to detect pressure-induced conformational changes

• Microfluidic platforms:

  • High-throughput bacterial growth and morphology analysis

  • Single-cell tracking of division dynamics across mutant libraries

  • Pressure-variable microfluidic devices for real-time observation of adaptation

  • Droplet-based assays for protein-protein interaction screening

• Computational approaches:

  • Machine learning prediction of pressure-stabilizing mutations

  • Molecular dynamics simulations of swp_1903 under varying pressure conditions

  • Systems biology modeling of the entire cell division apparatus

  • Evolutionary sequence analysis to predict functional residues

These high-throughput approaches would generate comprehensive datasets that, when integrated, could rapidly advance understanding of swp_1903 structure, function, and evolution. The resulting insights would contribute to broader knowledge of bacterial adaptation to extreme environments and potentially inform biotechnological applications of pressure-adapted proteins .