Recombinant Shewanella piezotolerans Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Shewanella piezotolerans

Shewanella piezotolerans strain WP3 is a remarkable deep-sea bacterium isolated from western-Pacific sediment at a depth of 1,914 meters. This organism has evolved specific adaptations that allow it to thrive under conditions of high pressure (piezotolerance) and low temperature (psychrotolerance), reflecting its successful adaptation to the extreme deep-sea environment . Phylogenetically, S. piezotolerans belongs to group 1 of the Shewanella genus, which is distinct from the more extensively studied group 2 species .

S. piezotolerans WP3 demonstrates considerable metabolic flexibility, enabling it to utilize diverse carbon sources and electron acceptors, a characteristic shared with other Shewanella species . The complete genome sequencing of WP3 has revealed the presence of numerous c-type cytochrome genes, which support anaerobic respiration using various terminal electron acceptors, including nitrate, iron, trimethylamine-N-oxide (TMAO), and dimethyl sulfoxide (DMSO) . This metabolic versatility contributes to the organism's ecological success in nutrient-fluctuating deep-sea environments.

Genomic and Metabolic Characteristics

The genome-scale metabolic model (GEM-iWP3) developed for S. piezotolerans provides significant insights into the organism's metabolic capabilities. This comprehensive model encompasses 806 genes, 653 metabolites, and 922 metabolic reactions . The reconstruction includes central metabolic functions that represent nonhomologous replacements between group 1 and group 2 Shewanella species, highlighting the evolutionary divergence within this genus .

Table 1: Key Genomic and Metabolic Features of Shewanella piezotolerans WP3

FeatureDescription
Genome-Scale ModelGEM-iWP3
Total Genes in Model806
Total Metabolites653
Total Metabolic Reactions922
Phylogenetic ClassificationShewanella group 1
Environmental AdaptationsPiezotolerant, Psychrotolerant
Isolation SourceWestern-Pacific sediment, 1,914 m depth
Key Metabolic CapabilitiesDiverse carbon utilization, multiple electron acceptors
Notable Physiological TraitsProduction of EPA, altered lipid content at low temperature/high pressure

A distinctive feature of S. piezotolerans is its ability to produce eicosapentaenoic acid (EPA) and modify its lipid composition to include more unsaturated and branched-chain fatty acids when exposed to low-temperature and high-pressure environments . These membrane adaptations are crucial for maintaining cellular function under the extreme conditions of the deep sea.

Overview of Ubiquinone Biosynthesis and UbiB Proteins

Ubiquinone, also known as coenzyme Q, is an essential lipid-soluble electron carrier in the respiratory chains of most aerobic organisms. The biosynthesis of ubiquinone involves a complex pathway comprising multiple enzymatic steps, with the UbiB protein playing a critical regulatory role in this process.

Function and Structure of UbiB

Based on information from related Shewanella species, UbiB is characterized as a probable protein kinase that regulates the activity of UbiI, an enzyme involved in aerobic coenzyme Q (ubiquinone) biosynthesis . The protein is classified under the Enzyme Commission (EC) number 2.7.-.- as an enzyme involved in transferring phosphorus-containing groups . This classification suggests that UbiB likely functions by phosphorylating target proteins in the ubiquinone biosynthetic pathway.

Characterization of UbiB in Shewanella Species

The UbiB protein appears to be conserved across multiple Shewanella species, suggesting its fundamental importance in bacterial metabolism. While direct information about UbiB in S. piezotolerans WP3 is limited in the available research, comparative analysis with other Shewanella species provides valuable insights into its probable characteristics and functions.

Evolutionary Conservation and Divergence

Evolutionary analysis of metabolic genes in Shewanella has revealed instances of nonhomologous replacements among group 1 and group 2 species . While this observation was not specifically reported for the ubiB gene, it illustrates the complex evolutionary history of metabolic genes within the Shewanella genus. The presence of UbiB across different Shewanella species suggests that this protein serves a conserved function in ubiquinone biosynthesis, despite potential variations in sequence and structure.

The genome-scale model of S. piezotolerans WP3 provides a framework for understanding the metabolic context in which UbiB functions. The model highlights the metabolic flexibility of this organism, which could be partially attributed to efficient energy production systems, including the ubiquinone-dependent respiratory chain .

Recombinant Expression of UbiB

Recombinant expression of S. piezotolerans UbiB would involve the isolation of the ubiB gene from the organism's genome, followed by cloning and expression in a suitable host system. The resulting recombinant protein could be purified and characterized to determine its specific biochemical properties, substrate specificities, and regulatory mechanisms.

The expression of recombinant UbiB from a piezotolerant and psychrotolerant organism like S. piezotolerans WP3 could yield a protein with unique properties adapted to function under extreme conditions. Such characteristics might include enhanced stability at high pressures and low temperatures, which could be valuable for various biotechnological applications.

Potential Functions and Applications of Recombinant UbiB

The recombinant expression of S. piezotolerans UbiB opens up several possibilities for both fundamental research and practical applications. Understanding the specific functions of this protein could provide insights into bacterial adaptation to extreme environments and the evolution of energy metabolism pathways.

Research Applications

Recombinant S. piezotolerans UbiB could serve as a valuable tool for investigating the regulatory mechanisms of ubiquinone biosynthesis under various environmental conditions. The protein could be used in biochemical assays to identify its specific substrates and to characterize its kinetic parameters, providing a deeper understanding of its role in cellular metabolism.

Furthermore, structural studies of recombinant UbiB could reveal the molecular adaptations that enable this protein to function effectively under high-pressure and low-temperature conditions. Such insights would contribute to our understanding of protein structure-function relationships in extremophilic organisms.

Biotechnological Potential

The unique properties of S. piezotolerans UbiB, particularly its potential adaptation to extreme conditions, could be harnessed for various biotechnological applications. Enzymes from extremophiles often exhibit enhanced stability and activity under harsh conditions, making them valuable biocatalysts for industrial processes.

Table 3: Potential Applications of Recombinant S. piezotolerans UbiB

Application AreaPotential Use
BiocatalysisEnzyme-catalyzed reactions under extreme conditions
Pharmaceutical IndustryProduction of ubiquinone-based therapeutic compounds
BioenergyEnhancement of microbial energy production systems
Protein EngineeringTemplate for designing pressure-resistant enzymes
Structural BiologyModel for studying protein adaptation to extreme environments
Metabolic EngineeringOptimization of ubiquinone production in industrial strains

Current Research and Future Perspectives

Research on S. piezotolerans and its metabolic enzymes, including UbiB, represents an emerging field with significant potential for advancing our understanding of microbial adaptation to extreme environments. The genome-scale model of S. piezotolerans WP3 provides a valuable framework for investigating the metabolic network in which UbiB functions .

Integration with Systems Biology Approaches

The model could also be used to design experiments for validating the predicted functions of UbiB and other enzymes involved in energy metabolism. Such an integrative approach would provide a more comprehensive understanding of how S. piezotolerans adapts its energy production systems to the challenging conditions of the deep sea.

Comparative Studies with Other Shewanella Species

Comparative analysis of UbiB across different Shewanella species could reveal evolutionary patterns and functional adaptations specific to particular environmental niches. The existing knowledge about UbiB in S. baltica OS155 provides a starting point for such comparative studies .

The differences between group 1 and group 2 Shewanella species in terms of metabolic gene content and organization offer an interesting context for investigating the evolution of ubiquinone biosynthesis pathways . Analysis of the ubiB gene and its genomic context across multiple Shewanella species could provide insights into the selective pressures that have shaped this important metabolic pathway.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; swp_0449; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Shewanella piezotolerans (strain WP3 / JCM 13877)
Target Names
ubiB
Target Protein Sequence
MTVKSIKRAYQVIRTTLHYGLDDLIPSKVTPWYFKLLRGSLFWLRNKHKDKVGGERLKLA MQELGPVYIKFGQMLSTRRDLLSDEWAEELAMLQDRVPPFDSAIARESIEQELNAPIETY FDDFEDTPLASASISQVHTATLKSNGAKVVLKVLRPDVEQKVHADIQLMSQAANFLESLL GANNRLRPAEVVEDYRTTIEGELNLKLEALNAIKLRNNFLDSNALYIPYMYEELCFTRLI VMERIDGVPVSDKAALEAQGTNLKLLAERGVELFFTQVFRDNFFHADMHPGNIFVSREHP NDPFYIGLDCGIMGTLTDEDKRYLAENFLAFFNRDYRRIAQLYIESGWVSADTDISAFEQ AVKVVCEPMFNKPLDEISFGHVLLELFRTARRFDMVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLEDWMAEQVGPKAMAGKIKQQLPYWADQLPELPELIYDNLKMGRNLAKT HNKLLDRYLKHQQKAHKSNYLLITSAILVICGTILLNQDATLWASYGSIGTGLILWVLGW RSRPKNRKF
Uniprot No.

Target Background

Function
This protein is likely a regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Probable ubiquinone biosynthesis protein UbiB in Shewanella piezotolerans?

The Probable ubiquinone biosynthesis protein UbiB in Shewanella piezotolerans (strain WP3 / JCM 13877) is a protein encoded by the ubiB gene (locus name: swp_0449) that is likely involved in the biosynthesis of ubiquinone (Coenzyme Q), an essential component of the electron transport chain. The protein consists of 549 amino acids and has been identified through genomic analysis and annotation .

UbiB belongs to a family of proteins involved in the ubiquinone biosynthetic pathway. In bacterial systems, ubiquinone plays a crucial role in aerobic and anaerobic respiration by facilitating electron transfer processes. While the exact function of UbiB in S. piezotolerans hasn't been fully characterized experimentally, comparative genomics suggests its involvement in ubiquinone biosynthesis based on homology with better-studied bacterial systems .

How does S. piezotolerans differ from other Shewanella species in its metabolic capabilities?

S. piezotolerans strain WP3 belongs to group 1 of the Shewanella genus and is distinct from the more extensively studied group 2 species like S. oneidensis MR-1. As a piezotolerant (pressure-tolerant) and psychrotolerant (cold-tolerant) deep-sea bacterium, it has evolved specific metabolic adaptations for its environment .

When examining the metabolic reconstruction of S. piezotolerans WP3, researchers have identified several key differences from group 2 Shewanella species. Evolutionary analysis has revealed instances of nonhomologous replacements in central metabolic genes between group 1 and group 2 species. Specifically, genes like argE and nagB in WP3 and other group 1 species were found to be conserved within bacterial species closely related to Shewanella, potentially representing ancestral genes preserved during early differentiation of the Shewanella genus .

The genome-scale metabolic model (GEM-iWP3) demonstrated that WP3 possesses greater flexibility in ATP production under anaerobic conditions compared to group 2 species like S. oneidensis MR-1. This metabolic flexibility is likely advantageous for adaptation to the fluctuating availability of organic carbon sources in the deep sea environment .

What is the relationship between ubiquinone biosynthesis and oxygen availability in bacterial systems?

In E. coli, for example, the O2-independent pathway relies on three proteins: UbiT (YhbT), UbiU (YhbU), and UbiV (YhbV). UbiT contains an SCP2 lipid-binding domain and likely functions as an accessory factor, while UbiU and UbiV form a heterodimer that functions as a novel class of O2-independent hydroxylases. Each protein in the UbiU-UbiV complex binds a 4Fe-4S cluster via conserved cysteines that are essential for activity .

For bacteria like Shewanella species that inhabit environments with fluctuating oxygen levels, having both O2-dependent and O2-independent pathways for ubiquinone biosynthesis allows them to optimize metabolism across the entire oxygen range. This metabolic flexibility is particularly important for S. piezotolerans as a deep-sea bacterium where oxygen availability can vary significantly .

What are the recommended protocols for expressing and purifying recombinant UbiB from S. piezotolerans?

When expressing and purifying recombinant UbiB from S. piezotolerans, researchers should employ a systematic approach based on established recombinant protein methodologies, adapted for this specific protein.

Expression System Selection:
Begin by cloning the ubiB gene (swp_0449) into an appropriate expression vector. For initial attempts, E. coli BL21(DE3) serves as a suitable host due to its reduced protease activity. Consider using vectors with tags that facilitate purification and detection (His-tag, GST, etc.). The full-length coding sequence (covering amino acids 1-549) should be used, although expression of problematic proteins may benefit from domain-based constructs .

Optimization Parameters:
Systematically test expression conditions including:

  • Temperature: Try reduced temperatures (16-20°C) for expression, which often improves folding of complex proteins

  • Induction conditions: Test various IPTG concentrations (0.1-1.0 mM)

  • Media supplementation: Consider adding iron salts to facilitate formation of potential iron-sulfur clusters, as seen in related proteins UbiU-UbiV that utilize 4Fe-4S clusters

Purification Strategy:

  • Initial capture: Affinity chromatography based on the chosen tag

  • Intermediate purification: Ion exchange chromatography

  • Polishing: Size exclusion chromatography

Buffer Considerations:
The storage buffer should be Tris-based with 50% glycerol for stability. For working with the purified protein, consider including reducing agents (DTT or β-mercaptoethanol) to maintain any potential iron-sulfur clusters in a reduced state .

Quality Control:
Verify protein identity via mass spectrometry and assess purity through SDS-PAGE. Functional assays should be developed based on predicted ubiquinone biosynthesis activity, potentially measuring interactions with ubiquinone precursors.

How can researchers design assays to measure UbiB activity in vitro?

Designing effective assays to measure UbiB activity in vitro requires understanding its potential biochemical function in the ubiquinone biosynthesis pathway. Since the exact function of UbiB in S. piezotolerans remains somewhat speculative, researchers should develop multiple complementary approaches:

Approach 1: ATP-Binding/Hydrolysis Assays
UbiB proteins in other organisms have been suggested to bind ATP, possibly functioning as kinases. Researchers can:

  • Employ fluorescent ATP analogs to measure binding kinetics

  • Use malachite green assays to detect phosphate release from ATP hydrolysis

  • Apply isothermal titration calorimetry (ITC) to determine binding affinities

Approach 2: Substrate Interaction Studies
Based on the ubiquinone biosynthetic pathway:

  • Synthesize or obtain potential ubiquinone precursors

  • Develop chromatographic methods (HPLC) to detect substrate modifications

  • Use radiolabeled substrates to track conversion between intermediates

Approach 3: Protein-Protein Interaction Assays
Since ubiquinone biosynthesis often involves multi-protein complexes (as seen with UbiU-UbiV heterodimers in E. coli) :

  • Apply pull-down assays to identify interacting partners

  • Use surface plasmon resonance to measure binding kinetics

  • Employ bacterial two-hybrid systems to verify interactions in vivo

Approach 4: Anaerobic vs. Aerobic Activity Comparisons
Given the existence of O₂-dependent and O₂-independent pathways :

  • Establish parallel assay conditions with identical components except for oxygen availability

  • Use an anaerobic chamber for O₂-independent assays

  • Compare activity rates under both conditions to determine oxygen dependence

Experimental Controls:

  • Negative controls: Heat-denatured protein, catalytically inactive mutants

  • Positive controls: Well-characterized enzymes from related pathways

  • Species-specific controls: Equivalent proteins from group 2 Shewanella for comparative analysis

What considerations should be taken into account when working with piezotolerant proteins like those from S. piezotolerans?

Working with proteins from piezotolerant organisms like S. piezotolerans requires special considerations to account for their adaptation to high-pressure environments:

Pressure Effects on Protein Structure:
Proteins from piezotolerant organisms often possess structural adaptations that affect their stability and activity at different pressures. Researchers should consider:

  • Conducting activity assays at both atmospheric and elevated pressures using specialized high-pressure equipment

  • Examining structural changes at different pressures using techniques like high-pressure circular dichroism or FTIR

  • Comparing kinetic parameters (Km, Vmax) at various pressures to identify optimal conditions

Temperature Considerations:
S. piezotolerans is not only piezotolerant but also psychrotolerant (cold-adapted). Therefore:

  • Perform experiments at temperatures ranging from 4°C to 37°C to assess temperature-dependent activity

  • Evaluate protein stability at these different temperatures

  • Consider the interplay between pressure and temperature effects, as they may have synergistic impacts on protein function

Buffer Formulation:
Special attention should be paid to buffer composition:

  • Some buffers have significant pressure-dependence in their pKa values

  • Include osmolytes that may help maintain protein structure under varying conditions

  • Consider the effect of salt concentration, as ionic interactions can be affected by pressure

Protein Expression and Purification:
When producing recombinant proteins:

  • Express at lower temperatures (15-20°C) to better mimic native conditions

  • Consider using expression systems adapted for cold temperatures

  • During purification, maintain samples at temperatures that prevent thermal denaturation of potentially cold-adapted proteins

Storage Stability:
For long-term storage:

  • Test stability in different buffer conditions with and without glycerol

  • Determine if flash-freezing or slow cooling is more appropriate

  • Evaluate activity after multiple freeze-thaw cycles to establish optimal handling protocols

By accounting for these considerations, researchers can better preserve the native characteristics of piezotolerant proteins and obtain more biologically relevant results.

How can researchers differentiate between the roles of UbiB and other ubiquinone biosynthesis proteins in metabolic studies?

Differentiating between the specific roles of UbiB and other ubiquinone biosynthesis proteins presents several analytical challenges that require multifaceted approaches:

Genetic Manipulation Strategies:

  • Generate targeted gene knockouts of ubiB and other ubiquinone biosynthesis genes

  • Create complementation strains where the deleted gene is reintroduced on a plasmid

  • Develop conditional expression systems to control protein levels

  • Design domain-specific mutations to disrupt particular functions while preserving others

This genetic toolkit allows researchers to systematically evaluate phenotypic effects and establish functional relationships .

Metabolomic Profiling:
Perform detailed metabolomic analysis to:

  • Quantify ubiquinone and intermediate metabolite levels using LC-MS/MS

  • Track isotopically labeled precursors to determine metabolic flux through the pathway

  • Compare metabolite profiles between wild-type and mutant strains under varying oxygen conditions

Transcriptional Response Analysis:
Employ RNA-seq or qRT-PCR to:

  • Measure expression changes of all ubiquinone biosynthesis genes under different conditions

  • Identify potential compensatory mechanisms when one pathway component is disrupted

  • Discover regulatory relationships between pathway components

When analyzing transcriptional data, cluster analysis can reveal genes with similar expression patterns, potentially indicating functional relationships or regulatory grouping .

Protein-Protein Interaction Network:
Map the interaction network using:

  • Immunoprecipitation followed by mass spectrometry

  • Bacterial two-hybrid screens

  • Proximity labeling approaches (BioID, APEX)

Network visualization tools can help identify whether UbiB acts independently or as part of a complex, similar to the UbiU-UbiV heterodimer system observed in E. coli .

Comparative Analysis Across Species:
Compare experimental findings with known pathways in:

  • Group 2 Shewanella species where metabolic pathways are better characterized

  • Model organisms like E. coli where both O₂-dependent and O₂-independent pathways exist

  • Distantly related organisms to identify evolutionarily conserved functions

Researchers should construct phylogenetic trees of ubiquinone biosynthesis proteins to provide evolutionary context for functional predictions .

What statistical approaches are recommended for analyzing data from experiments comparing UbiB function across different Shewanella species?

When analyzing data comparing UbiB function across different Shewanella species, researchers should employ robust statistical approaches that account for biological variability and enable meaningful comparisons:

Experimental Design Considerations:

  • Include biological replicates (minimum n=3) for each species tested

  • Account for batch effects by randomizing experiments or including batch as a factor in analysis

  • Include appropriate positive and negative controls specific to each species

Normalization Strategies:
Before comparative analysis:

  • Normalize protein expression levels relative to a conserved housekeeping gene or total protein content

  • For enzymatic activity, normalize to protein concentration or cell number

  • Consider relative metabolite abundances rather than absolute values when comparing across species

Recommended Statistical Tests:

  • For comparing means across multiple species:

    • One-way ANOVA followed by appropriate post-hoc tests (Tukey's HSD for all pairwise comparisons)

    • Kruskal-Wallis test (non-parametric alternative) when assumptions of normality are violated

  • For correlation analysis between UbiB activity and physiological parameters:

    • Pearson correlation for linear relationships with normally distributed data

    • Spearman rank correlation for non-parametric relationships

  • For multivariate analysis of complex datasets:

    • Principal Component Analysis (PCA) to identify patterns across species

    • Hierarchical clustering to group species by functional similarity

    • PERMANOVA to test for significant differences between groups while accounting for multiple variables

Advanced Analysis Techniques:

  • Linear mixed-effects models when dealing with repeated measures or nested experimental designs

  • Bayesian approaches for integrating prior knowledge about evolutionary relationships

  • Machine learning algorithms to identify patterns predictive of functional differences

Visualization Approaches:

  • Create heatmaps showing UbiB activity across species under various conditions

  • Use volcano plots to visualize significant differences in multi-omics datasets

  • Employ network diagrams to show evolutionary relationships alongside functional data

When interpreting results, consider the evolutionary relationships between the Shewanella species (e.g., group 1 vs. group 2 lineages) as this provides crucial context for understanding functional divergence .

How can researchers account for environmental variables when studying UbiB function in piezotolerant organisms?

Studying UbiB function in piezotolerant organisms like S. piezotolerans requires careful consideration of environmental variables that influence protein activity and regulation. Researchers should implement the following methodological approaches:

Pressure-Controlled Experiments:

  • Utilize specialized high-pressure equipment that can maintain precise pressure levels during experiments

  • Design experiments with pressure gradients (0.1-60 MPa) to determine pressure optima and thresholds

  • Establish time-course experiments at different pressures to assess adaptation responses

  • Implement appropriate controls at atmospheric pressure for comparison

Temperature Considerations:

  • Conduct experiments across a temperature range relevant to the organism's natural habitat (4-20°C for deep-sea organisms)

  • Analyze temperature-pressure interactions using factorial experimental designs

  • Calculate activation energies (Ea) at different pressures to understand thermodynamic relationships

Oxygen Availability Modulation:
Since ubiquinone biosynthesis can occur through O2-dependent and O2-independent pathways :

  • Control dissolved oxygen levels precisely using specialized bioreactors

  • Establish experiments under fully aerobic, microaerobic, and anaerobic conditions

  • Measure ubiquinone production rates across oxygen gradients

  • Compare the relative contributions of different biosynthetic pathways under varying oxygen conditions

Nutrient Availability:

  • Design experiments with varying carbon source availability to mimic fluctuating deep-sea conditions

  • Measure UbiB expression and activity under different nutrient limitations

  • Develop chemostat cultures to maintain steady-state growth under defined nutrient conditions

Statistical Handling of Environmental Variables:

  • Employ response surface methodology (RSM) to model the effects of multiple environmental variables simultaneously

  • Use generalized additive models (GAMs) to capture non-linear relationships between variables

  • Implement principal component analysis (PCA) to identify which environmental variables explain most of the variance

Data Integration and Modeling:

  • Develop multivariate models that predict UbiB activity based on environmental parameters

  • Integrate experimental data with genome-scale metabolic models like GEM-iWP3

  • Simulate metabolic responses to environmental changes using flux balance analysis

Table 1: Recommended environmental variable ranges for S. piezotolerans UbiB studies

Environmental VariableRange to TestSampling PointsControl Condition
Pressure0.1-60 MPa0.1, 10, 20, 30, 40, 50, 60 MPa0.1 MPa (atmospheric)
Temperature4-25°C4, 8, 12, 16, 20, 25°C15°C (typical deep-sea)
Oxygen Concentration0-100% saturation0, 5, 10, 25, 50, 75, 100%100% (fully aerobic)
pH6.0-8.56.0, 6.5, 7.0, 7.5, 8.0, 8.57.5 (typical seawater)
Salinity20-40 g/L NaCl20, 25, 30, 35, 40 g/L35 g/L (typical seawater)

By systematically controlling and varying these environmental parameters, researchers can develop a comprehensive understanding of how UbiB function adapts to the specific challenges of deep-sea environments.

How does the structure and function of UbiB relate to energy conservation in S. piezotolerans under anaerobic conditions?

The relationship between UbiB structure/function and energy conservation in S. piezotolerans under anaerobic conditions presents a complex research question that integrates multiple aspects of bacterial metabolism:

UbiB's Role in the Anaerobic Respiratory Chain:
While ubiquinone is traditionally associated with aerobic respiration, it also functions in anaerobic respiratory pathways in many bacteria. Based on genome-scale metabolic modeling of S. piezotolerans WP3, this organism likely uses substrate-level phosphorylation as the primary source of energy conservation under anaerobic conditions, a trait previously identified in other Shewanella species .

The GEM-iWP3 model revealed a positive correlation between the availability of reducing equivalents in the cell and the directionality of the ATP synthase reaction flux. This suggests that UbiB's role in ubiquinone biosynthesis could indirectly influence energy conservation by affecting the electron transport chain's efficiency under anaerobic conditions .

Structural Adaptations for Anaerobic Function:
UbiB likely possesses structural features optimized for function under anaerobic conditions. By analogy with the UbiU-UbiV system in E. coli, which contains 4Fe-4S clusters essential for O2-independent activity , researchers should investigate whether:

  • S. piezotolerans UbiB contains iron-sulfur clusters or other redox-active centers

  • These centers show altered redox potentials compared to aerobic homologs

  • The protein structure provides protection against oxidative damage during transitions between aerobic and anaerobic conditions

Metabolic Integration and Regulation:
To fully understand UbiB's role in anaerobic energy conservation:

  • Examine the regulation of ubiB expression under different oxygen conditions

  • Map metabolic fluxes through ubiquinone-dependent pathways using 13C-labeling

  • Compare the efficiency of energy generation (ATP/substrate) with and without functional UbiB

  • Investigate potential interactions between UbiB and anaerobic respiratory complexes

Evolutionary Adaptations in Deep-Sea Environments:
S. piezotolerans WP3 shows greater flexibility in ATP production under anaerobic conditions compared to Group 2 Shewanella species like S. oneidensis MR-1 . This flexibility could be advantageous for adaptation to fluctuating availability of organic carbon sources and electron acceptors in the deep sea. Researchers should investigate whether specific adaptations in UbiB contribute to this metabolic flexibility.

What are the methodological approaches for investigating evolutionary divergence of UbiB function between group 1 and group 2 Shewanella species?

Investigating the evolutionary divergence of UbiB function between group 1 and group 2 Shewanella species requires an integrated approach combining phylogenetic analysis, comparative biochemistry, and functional genomics:

Phylogenetic Analysis and Ancestral Sequence Reconstruction:

  • Collect UbiB sequences from diverse Shewanella species and related bacteria

  • Construct maximum-likelihood phylogenetic trees using appropriate evolutionary models

  • Identify evolutionary branch points between group 1 and group 2 Shewanella

  • Employ ancestral sequence reconstruction to infer the sequence of UbiB at key evolutionary nodes

  • Identify positions under positive selection using dN/dS ratio analysis

This approach allows researchers to identify specific amino acid changes that may have functional significance during evolutionary divergence .

Recombinant Expression and Comparative Biochemistry:

  • Express recombinant UbiB proteins from multiple representative species of both groups

  • Characterize biochemical properties including:

    • Substrate specificity

    • Kinetic parameters

    • Cofactor requirements

    • Temperature and pressure optima

  • Create chimeric proteins by swapping domains between group 1 and group 2 UbiB proteins

  • Generate site-directed mutants targeting amino acids identified in the phylogenetic analysis

Table 2: Proposed comparative analysis of UbiB properties across Shewanella groups

PropertyGroup 1 (e.g., S. piezotolerans)Group 2 (e.g., S. oneidensis)Method of Determination
Temperature optimum[To be determined][To be determined]Activity assays at 4-37°C
Pressure tolerance[To be determined][To be determined]High-pressure activity assays
Substrate affinity[To be determined][To be determined]Enzyme kinetics (Km determination)
Oxygen dependence[To be determined][To be determined]Anaerobic vs. aerobic activity
Protein stability[To be determined][To be determined]Thermal shift assays, CD spectroscopy
Redox properties[To be determined][To be determined]Cyclic voltammetry, EPR spectroscopy

Comparative Genomics and Synteny Analysis:

  • Examine the genomic context of ubiB across Shewanella species

  • Identify conserved and variable gene neighborhoods

  • Map mobile genetic elements that may have contributed to horizontal gene transfer

  • Analyze coevolution patterns between UbiB and other ubiquinone biosynthesis proteins

As observed in other metabolic genes, group 2 Shewanella species may have acquired certain genes through horizontal gene transfer, as evidenced by their adjacency to mobile genetic elements .

Functional Complementation Experiments:

  • Generate ubiB deletion mutants in representative species from both groups

  • Perform cross-species complementation by expressing UbiB from one group in the deletion mutant of the other

  • Quantify the degree of functional rescue under various conditions

  • Identify conditions where group-specific functions are evident

Protein-Protein Interaction Network Comparison:

  • Map interaction partners of UbiB in both groups using methods like co-immunoprecipitation

  • Identify conserved and divergent interaction partners

  • Determine whether functional differences correlate with changes in protein-protein interactions

This comprehensive approach will provide insights into how UbiB function has evolved in response to the different ecological niches occupied by group 1 and group 2 Shewanella species .

How can genome-scale metabolic models be used to predict the impact of UbiB mutations on S. piezotolerans metabolism?

Genome-scale metabolic models (GEMs) provide powerful platforms for predicting the systemic effects of genetic perturbations. The existing GEM-iWP3 for S. piezotolerans can be leveraged to predict the impact of UbiB mutations through several sophisticated approaches:

Model Refinement for UbiB-Specific Analysis:

  • Update the existing GEM-iWP3 model with detailed ubiquinone biosynthesis pathways

  • Incorporate gene-protein-reaction (GPR) associations specifically for UbiB

  • Integrate O2-dependent and O2-independent ubiquinone biosynthesis pathways

  • Calibrate the model using experimental data from wild-type S. piezotolerans

In Silico Mutation Analysis:

  • Simulate complete UbiB knockout by constraining relevant reactions to zero flux

  • Model partial activity mutants by applying proportional constraints to reaction fluxes

  • Create domain-specific perturbations by selectively constraining reactions associated with particular protein functions

  • Simulate double or triple mutants involving UbiB and other ubiquinone biosynthesis genes

Flux Balance Analysis (FBA) Applications:

  • Predict growth rates under various environmental conditions with and without functional UbiB

  • Identify alternative pathways that may compensate for UbiB deficiency

  • Determine minimal media requirements for mutant strains

  • Predict synthetic lethal interactions involving UbiB

Flux Variability Analysis (FVA):

  • Assess the flexibility of metabolic pathways when UbiB function is compromised

  • Identify reactions with increased or decreased flux ranges in mutant conditions

  • Determine which pathways show increased variability, indicating potential adaptations

Dynamic FBA and Regulatory Integration:

  • Incorporate temporal aspects to predict adaptation to UbiB mutation over time

  • Integrate known or predicted regulatory information affecting ubiquinone biosynthesis

  • Simulate transitions between aerobic and anaerobic conditions with various UbiB mutants

Multi-Objective Optimization:

  • Simultaneously optimize for multiple cellular objectives (e.g., growth, ATP production, redox balance)

  • Compare Pareto frontiers between wild-type and UbiB mutants

  • Identify trade-offs specific to ubiquinone biosynthesis limitations

Validation and Refinement Strategies:

  • Generate experimental data from UbiB mutants for model validation

  • Use metabolomics data to constrain model predictions

  • Iteratively refine the model based on experimental outcomes

  • Develop condition-specific models for different environmental parameters

Table 3: Predicted metabolic consequences of UbiB mutations based on GEM-iWP3 simulations

Metabolic ParameterPredicted Change in UbiB MutantConfidence LevelKey Alternative Pathways
Growth rate (aerobic)[To be simulated][To be determined][To be identified]
Growth rate (anaerobic)[To be simulated][To be determined][To be identified]
ATP production[To be simulated][To be determined][To be identified]
Redox balance[To be simulated][To be determined][To be identified]
Central carbon flux[To be simulated][To be determined][To be identified]
Biomass composition[To be simulated][To be determined][To be identified]

This systems biology approach allows researchers to generate testable hypotheses about the role of UbiB in S. piezotolerans metabolism and prioritize experimental directions based on model predictions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.