Recombinant Shewanella putrefaciens Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Overview of Shewanella putrefaciens

Shewanella putrefaciens is a Gram-negative bacterium known for its metabolic versatility, particularly its ability to perform anaerobic respiration using a variety of electron acceptors . It is found in diverse environments, including marine sediments, soil, and even as an opportunistic pathogen in humans . S. putrefaciens is of interest in bioremediation, as it can reduce metals and other compounds .

Fumarate Reductase and its Significance

Fumarate reductase is an enzyme that plays a crucial role in anaerobic respiration, specifically in the reduction of fumarate to succinate . In S. putrefaciens, a soluble fumarate reductase, flavocytochrome c, is produced under anaerobic conditions and shares sequence similarity with catalytic subunits of membrane-bound fumarate reductases from Escherichia coli and other bacteria . This enzyme is essential for fumarate respiration in vivo .

Recombinant Fumarate Reductase Subunit D (frdD)

The fumarate reductase enzyme complex consists of several subunits, including the frdD subunit. The frdD subunit is a component of the membrane-bound fumarate reductase complex, which is responsible for anchoring the enzyme to the membrane . Recombinant frdD refers to the frdD subunit that has been produced using recombinant DNA technology, allowing for its isolation and study in vitro .

Role in Anaerobic Respiration

Flavocytochrome c3 is essential for fumarate respiration in vivo, as demonstrated by the specific loss of the ability to grow with fumarate as a terminal electron acceptor when the chromosomal fccA gene (encoding flavocytochrome c3) is disrupted .

Clinical Relevance of Shewanella putrefaciens

Shewanella species, including S. putrefaciens, are emerging pathogens capable of causing severe infections, such as hepatobiliary, skin and soft tissue, gastrointestinal, and respiratory infections, as well as bacteremia . S. putrefaciens infections are often associated with underlying conditions such as hepatobiliary diseases, malignancy, chronic kidney disease, and diabetes mellitus .

Shewanella putrefaciens and DMSO Respiration

Shewanella species can respire poorly soluble substrates using enzymatic machinery localized outside the cell . S. oneidensis strains MR-1 can engage in "extracellular respiration" of minerals and dimethyl sulfoxide (DMSO) .

Cold Stress and Metabolic Changes in Shewanella putrefaciens

Under cold stress conditions, S. putrefaciens exhibits significant changes in metabolic pathways, including down-regulation of chemotaxis and motility, and up-regulation of tryptophan metabolism, histidine biosynthesis, and quorum sensing, which benefit biofilm formation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frdD; Sputcn32_0351; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Target Names
frdD
Target Protein Sequence
MINYSPKRSDEPIWWGLFGAGGVWFAMITPVTVLLMGILLPLHGFGVVDIGYDKVYAFVS HPIGGAFTVLSLSLPMWHAMHRVHHGLHDLQIHLGTVGKYACYLAAALVTVLATVWVIQL S
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella putrefaciens Fumarate reductase subunit D (frdD) and what is its role in bacterial metabolism?

Fumarate reductase subunit D (frdD) is a membrane anchor component of the fumarate reductase enzyme complex in Shewanella putrefaciens. The complete enzyme typically consists of four subunits (A-D) and catalyzes the reduction of fumarate to succinate during anaerobic respiration. Specifically, frdD functions as one of the membrane-anchoring subunits that helps position the catalytic components appropriately within the cell membrane. This enzyme is critical for the organism's ability to use fumarate as a terminal electron acceptor during anaerobic respiration, which is particularly important in oxygen-limited environments that Shewanella species often inhabit .

The frdD protein from Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) is relatively small, with an expression region spanning amino acids 1-121, and has a characteristic hydrophobic profile consistent with its membrane-associated function .

How does frdD differ among Shewanella species and strains?

While the specific search results don't provide comparative data on frdD across different Shewanella species, research on Shewanella strains shows significant variation in genetic elements that may affect their pathogenicity and metabolic capabilities. Different strains of S. putrefaciens can exhibit pathogenic, saprophytic, or even probiotic characteristics .

For example, S. putrefaciens Pdp11 is described as a probiotic strain for use in aquaculture, while other strains have been associated with diseases in fish species such as common carp, rainbow trout, and eel . These functional differences are likely reflected in variations in metabolic enzymes, potentially including components of the fumarate reductase complex.

What are the optimal conditions for expressing and purifying recombinant frdD protein?

Optimal expression and purification of recombinant Shewanella putrefaciens frdD requires careful consideration of its membrane-associated nature. Based on the available information and standard practices for membrane proteins:

Expression System:

  • E. coli BL21(DE3) or similar strains are commonly used for recombinant membrane protein expression

  • Expression vectors containing T7 or similar strong inducible promoters

  • Inclusion of appropriate fusion tags (His-tag, GST, etc.) to facilitate purification while maintaining protein function

Expression Conditions:

  • Lower induction temperatures (16-25°C) to minimize inclusion body formation

  • Reduced inducer concentration (e.g., 0.1-0.5 mM IPTG) and extended expression times (overnight)

  • Supplementation with membrane-stabilizing agents (glycerol, specific detergents) may improve yields

Purification Strategy:

  • Cell membrane isolation by differential centrifugation

  • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside, CHAPS)

  • Affinity chromatography using the fusion tag

  • Size exclusion chromatography for final purification

Storage Conditions:
For the purified recombinant protein, recommended storage conditions include:

  • Storage buffer: Tris-based buffer containing 50% glycerol

  • Short-term storage: 4°C for up to one week

  • Long-term storage: -20°C or -80°C

  • Avoid repeated freeze-thaw cycles

How can researchers investigate the interaction between frdD and other subunits of the fumarate reductase complex?

Investigating protein-protein interactions within the fumarate reductase complex requires multiple complementary approaches:

Biochemical Approaches:

  • Co-immunoprecipitation (Co-IP) with antibodies specific to individual subunits

  • Pull-down assays using recombinant tagged subunits

  • Cross-linking studies followed by mass spectrometry to identify interaction interfaces

  • Analytical ultracentrifugation to study complex formation

  • Surface plasmon resonance (SPR) to measure binding kinetics

Structural Biology Techniques:

  • X-ray crystallography of the entire complex or subcomplexes

  • Cryo-electron microscopy to visualize the assembled complex

  • NMR studies of individual domains and their interactions

  • Hydrogen-deuterium exchange mass spectrometry to identify interacting regions

Computational Methods:

  • Molecular docking to predict interaction surfaces

  • Molecular dynamics simulations to study the dynamics of the complex

  • Sequence co-evolution analysis to identify potentially interacting residues

Functional Assays:

  • Site-directed mutagenesis of predicted interface residues followed by activity assays

  • Reconstitution experiments with purified subunits to measure assembly and enzymatic activity

  • Membrane incorporation studies to assess the role of frdD in complex anchoring

What is the role of frdD in the pathogenicity and environmental adaptation of Shewanella putrefaciens?

The fumarate reductase complex, including the frdD subunit, may play significant roles in both pathogenicity and environmental adaptation of Shewanella putrefaciens:

Pathogenicity Mechanisms:
Shewanella species have been identified as emerging pathogens causing various infections in humans and fish . While direct evidence linking frdD to pathogenicity is limited in the search results, anaerobic respiration capabilities are often critical for survival within host tissues. The fumarate reductase complex enables S. putrefaciens to:

  • Survive in oxygen-limited environments within host tissues

  • Generate energy under anaerobic conditions during infection

  • Potentially contribute to persistence during infection

Notably, research has shown that different strains of S. putrefaciens exhibit varying degrees of pathogenicity, with some strains causing infections in fish species including common carp, rainbow trout, and eel . This variability might be partially explained by differences in metabolic capabilities, potentially including variations in the fumarate reductase complex.

Environmental Adaptation:
Shewanella species are known for their remarkable respiratory versatility, which allows them to thrive in diverse environments:

  • Anaerobic respiration using fumarate as an electron acceptor allows survival in sediments and other oxygen-depleted environments

  • The membrane anchoring provided by frdD may be optimized for different environmental conditions

  • Variations in the fumarate reductase complex might contribute to the ability of different strains to occupy specific ecological niches

Research has demonstrated that some S. putrefaciens strains have probiotic properties while others are pathogenic or saprophytic , suggesting adaptive specialization that may involve differences in respiratory capabilities.

What methodological approaches are recommended for studying the functional activity of recombinant frdD in vitro?

Assessing the functional activity of recombinant frdD requires specialized techniques due to its role as a membrane anchor rather than a catalytic subunit:

Membrane Incorporation Studies:

  • Liposome reconstitution with purified frdD to assess membrane integration

  • Fluorescence-based assays to measure protein orientation in membranes

  • Freeze-fracture electron microscopy to visualize membrane incorporation

Complex Assembly Assays:

  • In vitro reconstitution of the complete fumarate reductase complex using all purified subunits

  • Size exclusion chromatography to assess complex formation

  • Blue native PAGE to analyze intact complexes

  • Chemical cross-linking followed by SDS-PAGE to capture subunit interactions

Functional Activity Measurements:

  • Enzyme activity assays measuring fumarate to succinate conversion in reconstituted systems

  • Electron transfer measurements using artificial electron donors

  • Membrane potential measurements in proteoliposomes containing the reconstituted complex

  • Comparison of wild-type activity versus systems with modified or absent frdD

Structural Dynamics:

  • Hydrogen-deuterium exchange to monitor conformational changes

  • Electron paramagnetic resonance (EPR) spectroscopy to study the orientation of the complex in membranes

  • Fluorescence resonance energy transfer (FRET) to measure distances between subunits in the assembled complex

How can researchers effectively design mutation studies to investigate critical residues in frdD?

Designing effective mutation studies for frdD requires systematic approaches to identify and characterize functionally important residues:

Target Residue Identification:

  • Sequence conservation analysis across Shewanella species and other bacteria

  • Structural prediction to identify membrane-spanning regions and potential interaction surfaces

  • Hydrophobicity analysis to identify membrane-interacting regions

  • Comparison with known structures of homologous proteins from other organisms

Based on the sequence provided , potential targets include the highly hydrophobic regions consistent with transmembrane domains and the more polar regions that might interact with other subunits.

Mutation Strategy:

  • Alanine scanning of consecutive residues in predicted functional regions

  • Conservative substitutions (maintaining chemical properties) to refine functional understanding

  • Non-conservative substitutions to disrupt specific interactions

  • Introduction of reporter groups (e.g., cysteine residues for subsequent labeling)

Functional Analysis of Mutants:

  • Expression level and stability assessment

  • Membrane integration efficiency

  • Complex assembly capability with other subunits

  • Enzymatic activity of the reconstituted complex

  • In vivo complementation studies in frdD knockout strains

Data Analysis Framework:

  • Categorize mutations based on their effects (assembly defects vs. activity defects)

  • Correlate structural predictions with functional outcomes

  • Develop a comprehensive model of structure-function relationships

  • Iterative refinement of the model with targeted follow-up mutations

How is recombinant frdD being used in comparative studies between pathogenic and probiotic Shewanella strains?

Recombinant frdD can serve as a valuable tool in comparative studies between different Shewanella strains with varying functional characteristics:

Comparative Genomics and Proteomics:
Research has demonstrated that Shewanella putrefaciens includes strains with distinct functional characteristics - some are pathogenic to fish species, others are saprophytic, and at least one strain (Pdp11) has been characterized as probiotic for use in aquaculture . Comparative studies can examine:

  • Sequence variations in the frdD gene and protein across strains

  • Expression levels of frdD under different growth conditions

  • Potential associations between frdD variants and strain pathogenicity or probiotic properties

Functional Comparisons:

  • Enzymatic activity assays comparing fumarate reductase function across strains

  • Growth characteristics under anaerobic conditions with fumarate as electron acceptor

  • Membrane composition and organization differences that might affect frdD function

Genetic Complementation:

  • Cross-complementation studies with frdD from different strains

  • Generation of chimeric frdD proteins to identify functional domains

  • Assessment of the impact of plasmid-encoded factors found in pathogenic strains on frdD function

While direct evidence linking frdD variations to the pathogenic/probiotic dichotomy is not presented in the search results, the documented differences between strains suggest that comparative studies of metabolic components like fumarate reductase could yield valuable insights.

What are the challenges and solutions in developing antibodies against recombinant frdD for research applications?

Developing antibodies against frdD presents several challenges due to its nature as a membrane protein:

Challenges:

  • Limited immunogenicity of hydrophobic membrane-spanning regions

  • Difficulty in maintaining native conformation during immunization

  • Potential cross-reactivity with homologous proteins

  • Limited surface exposure in the assembled complex

Strategic Solutions:

ApproachMethodologyAdvantagesLimitations
Peptide antibodiesSynthesize immunogenic peptides from hydrophilic regionsWorks with denatured protein, high specificityMay not recognize native protein
Recombinant fragmentsExpress soluble domains of frdDBetter folding, higher yieldMay miss conformational epitopes
Full-length proteinUse detergent-solubilized purified proteinRecognizes native structureLower immunogenicity, technically challenging
Genetic immunizationDNA vaccines encoding frdDIn vivo expression with native foldingVariable expression levels

Validation Methods:

  • Western blotting against recombinant protein and native complexes

  • Immunoprecipitation under native conditions

  • Immunofluorescence microscopy to confirm specificity

  • Cross-reactivity testing against homologous proteins from related species

Applications of Anti-frdD Antibodies:

  • Tracking expression levels under different growth conditions

  • Localization studies using immunofluorescence or immunogold electron microscopy

  • Co-immunoprecipitation to study protein-protein interactions

  • Potential therapeutic or diagnostic applications in Shewanella infections

How does the function of frdD in Shewanella putrefaciens compare to homologous proteins in other bacterial species?

Understanding the evolutionary and functional relationships between frdD in Shewanella putrefaciens and homologous proteins in other bacteria provides important context:

Evolutionary Conservation:
The fumarate reductase complex is found in many facultative and anaerobic bacteria, though with variations in subunit composition and structural organization. Comparative analysis can reveal:

  • Degree of sequence conservation in the membrane anchor subunits

  • Evolutionary adaptations to different environmental niches

  • Structural variations that might impact function

Functional Comparisons:

  • Activity comparisons under standardized conditions

  • Substrate specificity differences

  • Regulatory mechanisms controlling expression

  • Environmental factors affecting enzymatic performance

Cross-Species Complementation:

  • Ability of frdD from different species to functionally substitute for each other

  • Identification of species-specific interactions with other subunits

  • Adaptation to different membrane compositions

Model Organisms for Comparison:

  • Escherichia coli - well-characterized fumarate reductase system

  • Other Shewanella species with different environmental adaptations

  • Pathogenic bacteria where fumarate reductase contributes to virulence

  • Extremophiles with adaptations to harsh environmental conditions

What are the most promising future research directions involving recombinant frdD?

The study of recombinant Shewanella putrefaciens frdD offers several promising research avenues:

Structure-Function Relationships:

  • High-resolution structural studies of the complete fumarate reductase complex

  • Investigation of conformational changes during catalytic activity

  • Detailed mapping of interaction surfaces between subunits

Biotechnological Applications:

  • Development of biosensors based on the electron transport capabilities

  • Engineering of fumarate reductase for biocatalysis applications

  • Potential use in microbial fuel cells and bioremediation

Medical and Environmental Applications:

  • Investigation of frdD as a potential antibiotic target for Shewanella infections

  • Study of fumarate reductase inhibitors as potential antimicrobials

  • Exploration of the role of frdD in environmental adaptations relevant to bioremediation

Comparative Microbiology:

  • Extended studies across Shewanella strains with different functional characteristics

  • Investigation of horizontal gene transfer and evolutionary history of frdD

  • Broader ecological studies on the role of anaerobic respiration in environmental adaptation

Research into Shewanella species has clinical relevance, as they have been identified as emerging pathogens worldwide, associated with both community- and hospital-acquired infections . Understanding the metabolic capabilities that enable their pathogenicity, including anaerobic respiration, could contribute to improved treatment strategies.

How can bioinformatics tools assist in characterizing and studying recombinant frdD?

Bioinformatics approaches offer powerful tools for investigating frdD structure, function, and evolution:

Sequence Analysis:

  • Identification of conserved domains and functional motifs

  • Prediction of transmembrane regions and protein topology

  • Evolutionary analysis through multiple sequence alignments

  • Detection of selective pressure on specific regions

Structural Prediction:

  • Homology modeling based on related structures

  • Ab initio modeling of unique regions

  • Prediction of protein-protein interaction surfaces

  • Molecular dynamics simulations of membrane integration

Functional Prediction:

  • Identification of potentially critical residues for function

  • Prediction of post-translational modifications

  • Metabolic pathway analysis and flux modeling

  • Analysis of gene neighborhood and potential operonic structures

Integrative Approaches:

  • Integration of -omics data to understand regulation and expression

  • Network analysis of protein-protein interactions

  • Systems biology modeling of anaerobic respiration

  • Comparative genomics across Shewanella strains with different characteristics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.