Recombinant Shewanella putrefaciens Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant PlsY is a 203-amino acid protein encoded by the plsY gene (UniProt ID: A1RMH7/A4Y4F4) and expressed in E. coli with an N-terminal His tag for purification . It functions as an acyl-phosphate–glycerol-3-phosphate acyltransferase (GPAT), catalyzing the first committed step in phospholipid biosynthesis. Key features include:

CharacteristicSpecification
Molecular Weight~23 kDa (calculated)
Source OrganismShewanella putrefaciens (strain CN-32/ATCC BAA-453)
Expression SystemEscherichia coli
TagHis tag (N-terminal)
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0); -20°C/-80°C
ReconstitutionSterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability

Role in Fatty Acid Biosynthesis

PlsY synthesizes lysophosphatidic acid (LPA), a precursor for phospholipids. Comparative genomic studies reveal that Shewanella species modulate fatty acid composition (e.g., branched-chain or unsaturated fatty acids) to adapt to low temperatures and high pressures . For example:

  • Cold Adaptation: EPA (eicosapentaenoic acid) production in Shewanella increases at low temperatures, regulated by transcriptional activators like PfaR . Though PlsY is not directly part of the EPA cluster, it supports membrane fluidity by initiating glycerophospholipid synthesis .

  • Stress Response: Branched-chain amino acid transporters (e.g., LIV-I) indirectly regulate PlsY activity by supplying substrates for branched-chain fatty acid synthesis, enhancing membrane stability .

Industrial and Biotechnological Uses

  • Enzyme Characterization: Recombinant PlsY is used to study acyltransferase kinetics and substrate specificity .

  • Lipid Engineering: Insights from PlsY function aid in metabolic engineering of bacteria for optimized lipid production under industrial conditions (e.g., low-temperature bioreactors) .

Comparative Genomic Findings

  • Gene Conservation: The plsY gene is conserved across Shewanella species, but EPA synthesis clusters (e.g., pfaABCD) vary. For instance, S. putrefaciens 200 has a fragmented pfaA gene disrupted by a transposase, yet retains functionality .

  • Regulatory Mechanisms: Overexpression of the transcription factor PfaR in S. putrefaciens W3-18-1 increases EPA yield by 1.8-fold at 16°C, highlighting interplay between lipid regulators and biosynthetic enzymes .

Challenges and Future Directions

While PlsY is well-characterized, industrial-scale applications face hurdles:

  • Low EPA Yield: Even with regulatory optimizations, EPA constitutes ≤0.13% of dry weight in engineered strains .

  • Stability Issues: Repeated freeze-thaw cycles degrade the enzyme, necessitating single-use aliquots .
    Future work may focus on fusion tags for improved stability or co-expression with EPA cluster genes to enhance lipid yields .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us for preferential development.
Synonyms
plsY; Sputcn32_1109; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Target Names
plsY
Target Protein Sequence
MSQLTLTLLMIVSAYLAGSISSAVLVCRMRGLPDPRSEGSGNPGATNVLRIGGASSAAMV LFFDMLKGALPTYLAYLMGIDAISLGLIAIAACLGHIYPIFFGFKGGKGVATAFGAMAPI GDDLAICLMASWVVLLLISRYSSLAAIITALLAPLYTWWLDERFTIPVAMLSTLIIIRHK DNIQRLLKGEESKVSRKKRPKNP
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). Importantly, it utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Shewanella putrefaciens Glycerol-3-phosphate acyltransferase (plsY) and what is its biological function?

Glycerol-3-phosphate acyltransferase (plsY) in Shewanella putrefaciens is a membrane-bound enzyme that catalyzes the first and rate-limiting step in the de novo biosynthesis of glycerophospholipids and triacylglycerol (TAG). This enzyme specifically transfers an acyl group from an acyl donor to the sn-1 position of glycerol 3-phosphate to form lysophosphatidic acid (LPA) .

In S. putrefaciens, plsY (locus tag Sputcn32_1109) consists of 203 amino acid residues and functions as an acyl-phosphate--glycerol-3-phosphate acyltransferase . Unlike some other GPATs that use acyl-CoA as the acyl donor, plsY utilizes acyl-phosphate as its substrate . The protein contains multiple transmembrane domains characteristic of membrane-integrated proteins, with its catalytic domain likely facing the cytoplasm .

This enzyme plays a crucial role in bacterial adaptation to environmental conditions, particularly in S. putrefaciens, which is known to thrive in variable environments including low temperatures . The lipid composition of cellular membranes significantly influences bacterial survival in challenging conditions, making plsY an essential player in S. putrefaciens physiology.

  • How does S. putrefaciens plsY differ from other bacterial glycerol-3-phosphate acyltransferases?

S. putrefaciens plsY differs from other bacterial GPATs in several key aspects:

  • Substrate specificity: Unlike the soluble GPAT found in plant chloroplasts that uses acyl-(acyl-carrier protein) as the acyl donor, S. putrefaciens plsY utilizes acyl-phosphate as its acyl donor .

  • Structural features: The S. putrefaciens plsY protein (203 amino acids) is significantly smaller than plant GPATs, which typically consist of approximately 460 amino acid residues (including a leader sequence of about 70 amino acids) .

  • Environmental adaptation: S. putrefaciens plsY likely has evolved functional characteristics adapted to the bacterium's ability to survive in various ecological niches, including low-temperature environments and under anaerobic conditions .

  • Membrane integration: S. putrefaciens plsY contains multiple transmembrane segments with hydrophobic amino acid compositions, characteristic of its membrane-embedded nature .

The amino acid sequence analysis reveals conserved motifs consistent with acyltransferase function, although the specific arrangement and composition of these motifs in S. putrefaciens plsY exhibit unique features compared to other bacterial acyltransferases.

  • What expression systems are most effective for producing recombinant S. putrefaciens plsY?

Based on research with similar membrane proteins and recombinant expression systems for Shewanella proteins, the following approaches have proven effective:

Recommended expression systems:

Optimization parameters for expression:

  • Temperature: Lower temperatures (16-25°C) improve solubility for membrane proteins

  • Inducer concentration: 0.1-0.5 mM IPTG typically optimal

  • Media composition: Rich media with 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl

  • Induction time: 4-16 hours depending on expression temperature

  • Addition of membrane-stabilizing agents (glycerol 5-10%)

When expressing S. putrefaciens membrane proteins, researchers have found that electroporation methods for introducing recombinant constructs are highly effective, with reported efficiencies of ~4.0 x 10^6 transformants/μg DNA .

  • What are the basic characteristics of the plsY gene in S. putrefaciens?

The plsY gene in S. putrefaciens (strain CN-32 / ATCC BAA-453) has the following characteristics:

  • Locus tag: Sputcn32_1109

  • Uniprot ID: A4Y4F4

  • Protein length: 203 amino acids

  • Molecular features: Contains multiple transmembrane domains

  • Genomic context: Located within the CN-32 chromosome, which has a total size of 4,631,110 bp with a G+C content of 44.66%

The amino acid sequence contains characteristic motifs for acyltransferase activity, including conserved residues involved in substrate binding and catalysis. The hydrophobicity profile is consistent with a membrane protein, with multiple predicted transmembrane segments that anchor the protein in the cell membrane .

The gene is likely regulated in response to environmental conditions, particularly during adaptation to temperature changes, as S. putrefaciens is known to modify its lipid composition in response to environmental stressors .

Advanced Research Questions

  • What experimental strategies should be employed to purify functional recombinant S. putrefaciens plsY?

Purifying functional membrane proteins like S. putrefaciens plsY presents significant challenges. The following methodological approach is recommended based on successful purification of similar membrane-bound acyltransferases:

Step-by-step purification protocol:

  • Membrane isolation:

    • Harvest cells and disrupt by sonication or French press

    • Remove unbroken cells and debris by low-speed centrifugation (5,000 × g, 10 min)

    • Collect membranes by ultracentrifugation (100,000 × g, 1 hour)

    • Wash membrane pellet with high-salt buffer to remove peripheral proteins

  • Solubilization optimization:

    • Screen detergents using a panel approach:

      DetergentConcentration RangeSuitability
      n-Dodecyl-β-D-maltoside (DDM)0.5-2%Mild, often preserves activity
      Digitonin0.5-1%Very mild, good for complexes
      LDAO0.5-1%Effective for bacterial membrane proteins
      SDS0.1-0.5%Harsh, may denature protein
    • Optimize solubilization conditions (temperature, time, pH, ionic strength)

    • Include stabilizing agents (glycerol 10-20%, specific lipids)

  • Affinity purification:

    • Use a tag system (His6, Strep-tag II, or FLAG-tag) positioned to avoid interference with transmembrane domains

    • Employ immobilized metal affinity chromatography (IMAC) with controlled imidazole gradient elution

    • Maintain detergent above critical micelle concentration (CMC) in all buffers

  • Activity preservation:

    • Include essential lipids (phosphatidylglycerol, cardiolipin) in purification buffers

    • Add stability enhancers (glycerol, specific ions, reducing agents)

    • Consider protein-lipid reconstitution into nanodiscs or liposomes for activity studies

  • Quality assessment:

    • Size-exclusion chromatography to evaluate monodispersity

    • Activity assays measuring transfer of radioactive or fluorescently labeled acyl groups

    • Thermostability assays to optimize buffer conditions

This approach addresses the challenges of purifying membrane proteins while maintaining their functional integrity, which is particularly important for enzymatic studies of plsY .

  • How can site-directed mutagenesis be applied to investigate the catalytic mechanism of S. putrefaciens plsY?

Site-directed mutagenesis provides a powerful tool for investigating the catalytic mechanism of S. putrefaciens plsY. Based on conserved structural features of acyltransferases, the following systematic approach is recommended:

Target residues for mutagenesis:

  • Conserved motifs in acyltransferases:

    • Focus on the HX₄D motif typically found in acyltransferases, which contains the catalytic histidine and aspartate residues

    • Target hydrophobic residues that likely line the acyl chain binding pocket

    • Examine positively charged residues potentially involved in binding the phosphate group of glycerol-3-phosphate

  • Specific mutation strategies:

    • Catalytic residues: H→A, D→N (eliminates function while preserving spatial characteristics)

    • Substrate binding residues: Conservative substitutions (e.g., F→Y, L→I) to probe specific interactions

    • Charged residues: R→K, E→D to investigate the importance of charge versus specific side chain requirements

  • Kinetic analysis of mutants:

    • Determine kcat and Km for both glycerol-3-phosphate and acyl-phosphate substrates

    • Analyze pH-dependence profiles to identify ionizable groups in catalysis

    • Perform substrate specificity studies with various acyl chain lengths and structures

  • Structural verification:

    • Circular dichroism to confirm secondary structure preservation

    • Limited proteolysis to assess tertiary structure integrity

    • Thermal shift assays to evaluate protein stability

This methodological approach allows for systematic investigation of the catalytic mechanism while controlling for structural perturbations that might complicate interpretation of results .

  • What are the most accurate methods for determining kinetic parameters of recombinant S. putrefaciens plsY?

Accurate determination of kinetic parameters for membrane-bound enzymes like S. putrefaciens plsY requires specialized approaches to address challenges related to substrate solubility, enzyme stability, and reaction monitoring. The following methodological framework is recommended:

Recommended assay systems:

  • Radioactive assay using ³H or ¹⁴C-labeled substrates:

    • Incorporate [¹⁴C]glycerol-3-phosphate or radiolabeled acyl donor

    • Extract lipid products using organic solvents

    • Quantify by scintillation counting

    • Advantages: High sensitivity, direct measurement of product formation

    • Limitations: Requires radioisotope handling facilities

  • Coupled enzyme assays:

    • Link acyltransferase activity to spectrophotometrically detectable reactions

    • Monitor release of phosphate from acyl-phosphate using malachite green assay

    • Advantages: Continuous monitoring, no radioisotopes required

    • Limitations: Potential interference from coupling enzymes

  • Mass spectrometry-based assays:

    • Direct quantification of lysophosphatidic acid product

    • Use internal standards for accurate quantification

    • Advantages: High specificity, no labels required

    • Limitations: Requires specialized equipment, sample processing

Experimental considerations for accurate kinetic analysis:

ParameterMethodological ApproachImportance
Substrate preparationUse of appropriate detergents/micellesEnsures substrate accessibility
Enzyme presentationReconstitution in liposomes or nanodiscsMaintains native-like environment
Reaction linearityTime-course analysisEnsures initial velocity conditions
Temperature controlPrecision water bath/temperature controllerCritical for reproducibility
pH optimizationBuffering capacity verificationEnsures stable pH during reaction
Product inhibitionProduct removal or low conversion ratesPrevents underestimation of activity

Data analysis approach:

  • Apply appropriate enzyme kinetic models (Michaelis-Menten, ping-pong bi-bi mechanism)

  • Use non-linear regression rather than linearization methods

  • Account for substrate partition coefficients between aqueous and micellar phases

  • Consider cooperative effects if observed

This comprehensive approach ensures accurate determination of kinetic parameters while addressing the specific challenges associated with membrane-bound acyltransferases .

  • How can genetic manipulation of S. putrefaciens be optimized for studying plsY function in vivo?

Genetic manipulation of S. putrefaciens presents unique challenges that require specialized approaches. The following methodological framework optimizes genetic studies of plsY function in vivo:

Transformation optimization:

Recent advances have greatly improved genetic manipulation of Shewanella species. An optimized electroporation protocol achieving ~4.0 x 10⁶ transformants/μg DNA has been developed . Key parameters include:

  • Cell preparation at exponential growth phase (OD₆₀₀ 0.4-0.6)

  • Multiple washing steps with decreasing concentrations of sucrose

  • High voltage (1.5-2.0 kV) with 1 mm gap cuvettes

  • Immediate recovery in rich media supplemented with carbon source

  • Cells can be frozen for long-term storage without significant loss of competence

Gene deletion strategies:

  • Recombineering system: A prophage-mediated genome engineering system using λ Red Beta homolog from Shewanella sp. W3-18-1 has been developed, allowing precise genome editing with ~5% recombinants among total cells .

  • CRISPR-Cas9 system: Recent adaptations for Shewanella have improved editing efficiency:

    • Use of species-specific promoters for guide RNA expression

    • Codon-optimization of Cas9 for expression in Shewanella

    • Temperature-sensitive plasmids for system curing

Conditional mutation approaches:

For essential genes like plsY, conditional approaches are necessary:

  • Inducible promoter replacement (tetracycline or arabinose-inducible systems)

  • Protein destabilization domains that respond to small molecules

  • CRISPRi for tunable gene repression

Phenotypic analysis:

To assess plsY function in vivo:

  • Membrane lipid composition analysis by liquid chromatography-mass spectrometry

  • Growth kinetics under varying temperatures (particularly at 4°C vs. 30°C)

  • Stress response assessment (osmotic, oxidative, temperature shock)

  • Biofilm formation capacity, which is enhanced at low temperatures in S. putrefaciens

This methodological framework enables comprehensive in vivo analysis of plsY function while addressing the specific challenges of genetic manipulation in Shewanella species .

  • What bioinformatic approaches can be used to predict structure-function relationships in S. putrefaciens plsY?

Predicting structure-function relationships for membrane proteins like S. putrefaciens plsY requires specialized bioinformatic approaches. The following methodological framework is recommended:

Sequence-based analysis pipeline:

  • Homology identification and evolutionary analysis:

    • Position-Specific Iterative BLAST (PSI-BLAST) against diverse bacterial genomes

    • Multiple sequence alignment using MUSCLE or T-Coffee algorithms optimized for membrane proteins

    • Phylogenetic analysis to identify evolutionary relationships with other bacterial acyltransferases

    • Conservation analysis to identify functionally important residues

  • Transmembrane topology prediction:

    • Consensus approach using multiple algorithms (TMHMM, HMMTOP, Phobius)

    • Validation using the positive-inside rule for cytoplasmic loops

    • Hydrophobicity analysis to identify potential membrane-spanning regions

    • Comparison with experimentally determined topologies of related proteins

  • Structural modeling:

    • Template identification using HHpred to find distant homologs with known structures

    • Membrane protein-specific modeling using Rosetta MP or AlphaFold

    • Model validation using ProSA, QMEAN, and membrane-specific validation tools

    • Refinement in implicit membrane environments

  • Functional site prediction:

    • Substrate binding pocket identification using CASTp or SiteMap

    • Electrostatic surface analysis to identify potential substrate interaction sites

    • Conservation mapping onto structural models to identify functional hotspots

    • Molecular docking of glycerol-3-phosphate and acyl-phosphate substrates

Structure-function validation approaches:

Computational PredictionExperimental Validation
Catalytic residuesSite-directed mutagenesis followed by activity assays
Substrate binding sitesBinding studies with substrate analogs
Conformational changesMolecular dynamics simulations in membrane environment
Protein-protein interactionsCo-immunoprecipitation experiments

Integration with experimental data:

  • Incorporate crosslinking data to validate proximity predictions

  • Use site-directed spin labeling and EPR data to validate conformational predictions

  • Integrate mass spectrometry data to identify post-translational modifications

This comprehensive bioinformatic approach provides testable hypotheses about structure-function relationships in S. putrefaciens plsY, guiding experimental design for functional characterization .

  • How does S. putrefaciens plsY activity respond to environmental stressors, particularly temperature?

S. putrefaciens demonstrates remarkable adaptability to environmental conditions, including temperature fluctuations. The following methodological approach allows for comprehensive analysis of plsY response to environmental stressors:

Temperature adaptation mechanisms:

S. putrefaciens exhibits significant physiological changes at low temperatures, forming biofilms with larger biomass and tighter structure at 4°C compared to 30°C . Transcriptomic analysis has revealed differential gene expression patterns under these conditions, suggesting temperature-dependent regulation of membrane lipid composition .

For plsY specifically, the following experimental approaches can characterize temperature response:

  • Biochemical characterization:

    • Enzyme activity assays at different temperatures (4-37°C range)

    • Thermal stability analysis using differential scanning fluorimetry

    • Temperature-dependent substrate specificity shifts

    • Arrhenius plot analysis to determine activation energy

  • Structural adaptations:

    • Circular dichroism spectroscopy at varying temperatures

    • Temperature-dependent changes in oligomerization state

    • Protein dynamics analysis using hydrogen-deuterium exchange mass spectrometry

    • Molecular dynamics simulations at different temperatures

Comprehensive stress response analysis:

Environmental StressorMethodological ApproachExpected plsY Response
Temperature variationEnzyme kinetics at 4°C, 15°C, 30°C, 37°CActivity optimum shifts, substrate preference changes
Oxidative stressH₂O₂ exposure, aerobic vs. anaerobic conditionsPossible regulation through cysteine modifications
pH stressActivity profiling across pH 5-9pH optimum shifts, buffer capacity requirements
Osmotic stressNaCl gradient experimentsMembrane fluidity compensation mechanisms
Nutrient limitationCarbon/nitrogen source restrictionAltered expression and substrate preference

Systems biology approach:

  • Transcriptomic analysis to identify co-regulated genes under stress conditions

  • Metabolomic profiling of glycerophospholipids and lysophosphatidic acids

  • Correlation of membrane lipid composition with stress response

  • Integration with global stress response networks in S. putrefaciens

This comprehensive approach provides insights into the adaptive mechanisms of S. putrefaciens plsY under varying environmental conditions, particularly temperature stress, which is critical given the bacterium's remarkable ability to thrive in diverse environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.