Recombinant Shewanella putrefaciens Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; Sputcn32_3339; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Target Names
mscL
Target Protein Sequence
MSLIKEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVADVIMPPIGIILGGVNFSDLSIV LQAAQGDAPSVVIAYGKFIQTVIDFTIIAFAIFMGLKAINTLKRKEEEAPKAPPAPTKEE ELLSEIRDLLKAQQEK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella putrefaciens and why is it a viable organism for mscL research?

Shewanella putrefaciens is a gram-negative, facultatively anaerobic bacterium that has gained significant research attention due to its unique physiological properties. It is one of several Shewanella species known to have clinical relevance, though it is considered a rare human pathogen compared to other species like S. algae .

S. putrefaciens possesses stronger saccharolytic activity than S. algae, being able to produce acid from maltose, glucose, and partially from sucrose and arabinose . This metabolic versatility, coupled with its ability to adapt to diverse environments, makes its membrane proteins—including mechanosensitive channels—particularly interesting research targets for understanding bacterial adaptation mechanisms.

The mscL protein in S. putrefaciens represents an important model for studying how bacteria sense and respond to mechanical stimuli, particularly osmotic pressure changes. Research on this protein can provide insights into bacterial survival mechanisms in changing environments, which may be particularly relevant given S. putrefaciens' ability to thrive in various ecological niches.

How do I accurately identify Shewanella putrefaciens for my research?

Accurate identification of S. putrefaciens is crucial for research validity, as misidentification between Shewanella species (particularly S. putrefaciens and S. algae) has been common in the scientific literature. Conventional biochemical and phenotypic characterization tests often fail to correctly distinguish between clinically relevant Shewanella species .

For rigorous identification, employ multiple methods:

  • MALDI-TOF mass spectrometry has shown promise for Shewanella species identification, though it requires further validation

  • 16S rRNA sequencing provides more reliable identification

  • Whole genome sequencing followed by digital DNA-DNA hybridization (dDDH) represents the gold standard for molecular species identification

When reporting your research, always specify the identification method used, as this has significant implications for result interpretation and comparison with other studies.

What is the general structure and function of bacterial mscL channels?

The Large-conductance mechanosensitive channel (mscL) is a membrane protein that acts as a pressure relief valve in bacteria. The general structure typically consists of:

  • A homopentameric arrangement of subunits forming a channel

  • Each subunit containing two transmembrane domains (TM1 and TM2)

  • A cytoplasmic helical bundle at the C-terminus

  • A narrow constriction (gate) formed by hydrophobic amino acids

The channel functions by responding to increased membrane tension, typically caused by osmotic downshock. When bacteria experience hypoosmotic stress, water rushes into the cell, increasing membrane tension. This tension causes a conformational change in the mscL protein, opening a large pore that allows the efflux of water, ions, and small molecules, thus preventing cell lysis.

How should I design experiments for cloning and expressing recombinant S. putrefaciens mscL?

When designing experiments for cloning and expressing the mscL gene from S. putrefaciens, consider the following methodological approach:

  • Gene identification and isolation:

    • Identify the mscL gene sequence using genomic databases or by comparison with known mscL sequences

    • Design primers that include appropriate restriction sites for subsequent cloning

    • Consider codon optimization if expressing in a heterologous host

  • Expression vector selection:

    • Choose vectors with strong, inducible promoters (e.g., T7, pBAD)

    • Include fusion tags (His-tag, MBP, GST) to facilitate purification and detection

    • Consider using vectors that have been successfully used for other membrane proteins

  • Host strain selection:

    • E. coli C41(DE3) or C43(DE3) strains are often preferred for membrane protein expression

    • Consider using S. oneidensis as a more closely related expression host for Shewanella proteins

  • Expression conditions optimization:

    • Test various induction temperatures (typically 16-30°C for membrane proteins)

    • Optimize inducer concentration and induction time

    • Consider using specialized media formulations to enhance expression

S. putrefaciens contains plasmids with functional repB proteins that have been explored in other Shewanella species for stable plasmid replication . This knowledge can be leveraged for developing specialized expression systems for mscL.

What experimental design approaches are appropriate for studying mscL function?

When designing experiments to investigate mscL function, consider these methodological frameworks:

  • Randomized Complete Block Design (RBD):

    • Useful when testing multiple variables affecting mscL function (e.g., different mutations, environmental conditions)

    • Allows blocking for factors known to affect measurements (e.g., protein batch, day of experiment)

  • Latin Square Design (LSD):

    • Particularly valuable when three factors might influence results (e.g., protein variant, membrane composition, and measurement method)

    • Helps eliminate two sources of variation simultaneously

    • Example application: Testing mscL function across different membrane compositions, pH values, and protein concentrations

For LSD implementation:

When reporting results, clearly describe your experimental design, including:

  • Definition of experimental units

  • Treatment randomization method

  • Replication strategy

  • Statistical analysis approach

How can I verify proper folding and function of recombinant S. putrefaciens mscL?

Verification of proper folding and function requires multiple complementary approaches:

Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to verify secondary structure content

  • Size-exclusion chromatography to confirm proper oligomeric state

  • Limited proteolysis to assess structural compactness

Functional verification:

  • Patch-clamp electrophysiology in reconstituted liposomes or spheroplasts

  • Osmotic downshock survival assays in mscL-deficient bacteria complemented with S. putrefaciens mscL

  • Fluorescence-based assays measuring solute efflux upon hypoosmotic shock

Activity comparison table:

MethodAdvantagesLimitationsKey Parameters to Measure
Patch-clampDirect measurement of channel activityTechnically challenging, low throughputConductance, gating threshold, open probability
Osmotic survivalPhysiologically relevant, moderate throughputIndirect measurement, qualitativeSurvival percentage, colony morphology
Fluorescence assaysHigh throughput, quantitativeIndirect measurement, potential artifactsFluorescence kinetics, dose-response relationship

How might the antimicrobial resistance profile of S. putrefaciens influence mscL research?

The antimicrobial resistance profile of S. putrefaciens has important implications for mscL research:

This resistance profile has several research implications:

  • Selection marker choice: When designing expression vectors for mscL, avoid antibiotic resistance markers to which S. putrefaciens may have natural resistance

  • Experimental design considerations: In functional studies using whole-cell approaches, carefully select antibiotics for selective pressure that won't interfere with membrane properties

  • Potential mscL-antibiotic interactions: Consider investigating whether mscL function is affected by antibiotics, particularly those acting on the cell membrane

  • Expression system design: When expressing S. putrefaciens mscL in heterologous hosts, be aware that associated genetic elements might confer unexpected resistance properties

The presence of plasmids in pathogenic strains but not in probiotic strains of S. putrefaciens suggests potential connections between horizontal gene transfer, pathogenicity, and membrane properties that could be relevant to mscL research.

What methods are appropriate for investigating the structure-function relationship in S. putrefaciens mscL?

Investigating structure-function relationships in S. putrefaciens mscL requires a multi-faceted approach:

  • Site-directed mutagenesis studies:

    • Systematically mutate key residues predicted to be involved in mechanosensation, gating, or ion conduction

    • Create a library of single, double, and composite mutants

    • Assess functional changes using electrophysiological and downshock survival assays

  • Structural biology approaches:

    • X-ray crystallography of the purified protein in detergent micelles

    • Cryo-electron microscopy to visualize different conformational states

    • Solid-state NMR spectroscopy to study dynamics in a membrane environment

  • Molecular dynamics simulations:

    • Simulate membrane tension effects on channel conformation

    • Model ion/water permeation through the channel

    • Investigate lipid-protein interactions specific to S. putrefaciens membrane composition

  • Cross-linking and accessibility studies:

    • Use cysteine scanning mutagenesis combined with thiol-reactive probes

    • Perform disulfide cross-linking to trap specific conformational states

    • Use mass spectrometry to identify interacting regions

Data from these approaches should be integrated to develop a comprehensive model of how S. putrefaciens mscL structure relates to its function in mechanical sensing and channel gating.

How does S. putrefaciens' environmental adaptability relate to mscL function?

S. putrefaciens demonstrates remarkable environmental adaptability, which may be reflected in specialized mscL functions:

S. putrefaciens is found in diverse environments, from marine settings to clinical specimens, suggesting robust adaptive mechanisms . This bacterium has lipophilic properties and bile affinity, as demonstrated by frequent isolation from oil emulsions and fatty foods . These characteristics suggest potential specializations in membrane composition and properties.

Research questions to investigate this relationship could include:

  • Comparative functional analysis:

    • Does S. putrefaciens mscL show different tension sensitivity compared to mscL from non-lipophilic bacteria?

    • Are there functional differences between mscL channels from pathogenic versus non-pathogenic Shewanella strains?

  • Environmental adaptation experiments:

    • How does growth in different osmotic environments affect mscL expression and function?

    • Does exposure to bile salts or lipophilic environments alter mscL properties?

  • Evolutionary analysis:

    • Compare mscL sequences across Shewanella species with different environmental niches

    • Identify potentially adaptive mutations through positive selection analysis

This research direction could provide insights into how mechanosensing contributes to bacterial adaptation to specialized ecological niches.

How can I overcome expression and purification challenges for S. putrefaciens mscL?

Membrane proteins like mscL present significant expression and purification challenges. Based on experience with similar proteins, consider these methodological solutions:

Expression optimization strategies:

  • Controlled expression levels:

    • Use weak promoters or low inducer concentrations to prevent overwhelming the membrane insertion machinery

    • Test auto-induction media to achieve gradual protein expression

  • Fusion protein approaches:

    • N-terminal fusions with MBP or SUMO can improve folding and stability

    • C-terminal GFP fusions allow monitoring of expression and folding in real-time

  • Specialized host strains:

    • C41/C43(DE3) strains containing mutations that accommodate toxic membrane proteins

    • Lemo21(DE3) strain for tunable expression levels

Purification optimization:

  • Detergent screening:

    • Test mild detergents (DDM, LMNG, DMNG) and lipid-like detergents (amphipols, nanodiscs)

    • Consider fluorinated detergents for increased stability

  • Buffer optimization:

    • Include glycerol (10-20%) to stabilize the protein

    • Test various salt concentrations (150-500 mM) to minimize aggregation

    • Maintain pH in the 7.0-8.0 range unless specific conditions are needed

  • Purification strategy:

    • Two-step purification: IMAC followed by size exclusion chromatography

    • Consider on-column detergent exchange during affinity purification

Troubleshooting guide:

ProblemPossible CausesSolutions
Low expressionToxicity, poor translationReduce temperature, optimize codons, use specialized strains
AggregationImproper folding, detergent mismatchScreen detergents, add stabilizing agents, use fusion tags
ProteolysisExposed cleavage sitesAdd protease inhibitors, reduce expression time, engineer out susceptible sites
Inactive proteinDenaturation during purificationGentler purification conditions, validate with CD spectroscopy

What are effective approaches for functional characterization of S. putrefaciens mscL?

Functional characterization of mscL channels requires specialized techniques. Based on established protocols for mechanosensitive channels, consider these methodological approaches:

Electrophysiological characterization:

  • Patch-clamp analysis of reconstituted channels:

    • Reconstitute purified mscL into liposomes or planar lipid bilayers

    • Apply negative pressure to patches to induce channel opening

    • Measure single-channel conductance, gating threshold, and open probability

  • Spheroplast patch-clamp:

    • Express S. putrefaciens mscL in E. coli lacking endogenous mechanosensitive channels

    • Create spheroplasts by enzymatic digestion of the cell wall

    • Patch spheroplasts and apply suction to activate channels

Physiological characterization:

  • Hypoosmotic shock survival assays:

    • Express S. putrefaciens mscL in E. coli strains lacking endogenous MS channels

    • Subject cells to rapid osmotic downshock

    • Quantify survival rates and compare to positive and negative controls

  • Solute release assays:

    • Load cells or liposomes with fluorescent dyes

    • Apply osmotic downshock or mechanical stimulation

    • Measure dye release kinetics as an indicator of channel activity

Advanced functional analysis:

  • Single-molecule FRET:

    • Introduce fluorescent labels at key positions in mscL

    • Monitor conformational changes in response to membrane tension

    • Quantify transition states and energy landscapes

  • High-speed atomic force microscopy:

    • Visualize mscL channels in native-like membranes

    • Observe real-time conformational changes in response to mechanical stimuli

    • Correlate structural changes with functional measurements

How should I analyze electrophysiological data from S. putrefaciens mscL recordings?

Electrophysiological data from mscL recordings requires specialized analysis approaches:

Single-channel analysis:

  • Event detection and characterization:

    • Use threshold-crossing algorithms to identify channel openings

    • Measure dwell times in open and closed states

    • Construct amplitude histograms to identify conductance substates

  • Pressure-response relationship:

    • Plot channel open probability (Po) against applied pressure

    • Fit data to Boltzmann distribution to extract gating parameters:
      Po=11+exp[α(PP1/2)]P_o = \frac{1}{1 + \exp\left[-\alpha(P-P_{1/2})\right]}
      where P₁/₂ is the pressure at which Po = 0.5 and α is the slope factor

  • Energy calculations:

    • Calculate energy of channel gating using the relationship:
      ΔG=γΔA\Delta G = \gamma \Delta A
      where γ is membrane tension and ΔA is the change in protein cross-sectional area

Data presentation standards:

  • Required parameters to report:

    • Single-channel conductance (pS)

    • Pressure threshold for activation (mmHg)

    • Midpoint pressure (P₁/₂)

    • Channel kinetics (mean open and closed times)

  • Control measurements to include:

    • Baseline noise and conductance in the absence of protein

    • Recordings from known mscL variants (e.g., E. coli mscL) for comparison

    • Negative controls using inactive mutants

How can I address data variability when comparing different S. putrefaciens mscL variants?

Sources of variability in mscL research:

  • Biological variability:

    • Protein expression level differences

    • Variation in membrane composition

    • Host cell physiological state

  • Technical variability:

    • Reconstitution efficiency

    • Membrane patch geometry

    • Pressure application consistency

Statistical approaches for meaningful comparisons:

  • Hierarchical experimental design:

    • Group experiments by protein preparation batch

    • Use paired measurements when possible

    • Apply nested ANOVA to account for batch effects

  • Standardization protocols:

    • Normalize channel activity to protein amount

    • Use internal controls in each experiment

    • Standardize analysis protocols across all variants

  • Advanced statistical methods:

    • Use linear mixed-effects models to account for multiple sources of variance

    • Apply bootstrap resampling for robust parameter estimation

    • Conduct power analysis to ensure adequate sample sizes

Example data analysis workflow:

Analysis StepMethodOutput
Data preprocessingFiltering, baseline correctionClean traces for analysis
Event detectionIdealization algorithms (e.g., JSAP, QuB)Open/closed transitions
Parameter extractionMaximum likelihood fittingConductance, dwell times
Statistical comparisonMixed-effects modelsSignificance values, confidence intervals
VisualizationViolin plots, box plots with individual data pointsDistribution of parameter values

How should I interpret contradictory results in S. putrefaciens mscL research?

Contradictory results are common in membrane protein research. Here's a methodological approach to addressing them:

Systematic troubleshooting framework:

  • Identify potential sources of discrepancies:

    • Different experimental conditions (temperature, pH, ionic strength)

    • Variations in protein constructs (tags, mutations, truncations)

    • Differences in membrane environment (lipid composition, tension application)

    • Methodological differences (patch-clamp versus biochemical assays)

  • Validation experiments:

    • Replicate key experiments using multiple approaches

    • Test boundary conditions to identify parameter sensitivity

    • Use positive and negative controls to validate assay performance

  • Integration of multiple data types:

    • Combine structural, functional, and computational data

    • Look for consistent patterns across different experimental approaches

    • Develop mechanistic models that can explain apparent contradictions

Case-based reasoning approach:

When faced with contradictory results, consider creating a matrix of findings that maps results to experimental conditions. This can help identify patterns that explain discrepancies and develop testable hypotheses for resolution.

Collaborative verification:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.