Recombinant Shewanella putrefaciens Mercuric transport protein (merT)

Introduction to Shewanella putrefaciens and Mercury Transport Systems

Shewanella putrefaciens is a Gram-negative, motile, non-fermentative bacillus that has garnered significant scientific interest due to its remarkable metabolic versatility. This organism is primarily found in marine environments and is known for its ability to reduce various compounds, including iron and manganese oxides, under anaerobic conditions . While S. putrefaciens can occasionally act as an opportunistic human pathogen causing localized skin infections and rarely bacteremia , its environmental significance lies in its capacity to interact with and process various metals and toxic compounds.

The bacterium's genome encodes several specialized transport systems that facilitate its interactions with various metal compounds. Among these, the mercury transport system, which includes the merT protein, represents a sophisticated mechanism for managing toxic mercury compounds. The mercury transport system is particularly interesting as it demonstrates how bacteria have evolved specialized machinery to handle potentially lethal environmental toxins.

The mer Operon and Mercury Resistance

The mercury resistance mechanism in bacteria is typically encoded by the mer operon, a cluster of genes dedicated to mercury detection, transport, and detoxification. Within this operon, merT plays a crucial role as a transport protein that moves mercuric ions from the periplasm into the cell's cytoplasm. The merT gene is found downstream of the bidirectional promoter of merR and is 351 base pairs long . In the mer operon, merT is typically located upstream of merP, another gene that encodes a mercury transport protein .

This genetic arrangement facilitates coordinated expression of mercury resistance components, ensuring efficient management of toxic mercury compounds. The mer operon represents one of the most well-characterized metal resistance systems in bacteria and serves as a model for understanding how prokaryotes respond to environmental stressors.

Structure and Characteristics of merT Protein

The mercuric transport protein (merT) from Shewanella putrefaciens is a relatively small membrane protein with distinctive structural features that enable its mercury transport function. Understanding these structural elements provides insight into how this protein accomplishes its specialized role in mercury detoxification pathways.

Primary Structure and Sequence Features

Recombinant full-length merT protein from Shewanella putrefaciens consists of 115 amino acids, with the following sequence:
MSKSNPNFPIIGGVIAAIGAGLCCAGPFVLLLLGVSGSWIGNLTLLEPYRPIFILLVLAL FGFAGWKVYRPVEDCEPGTSCAVPQVRKRRQVIFWLTALTALVLVTSNYWIVWFA

This sequence reveals several key features that contribute to merT's function, particularly the presence of cysteine residues that play a critical role in mercury binding. The amino acid composition suggests a protein with multiple transmembrane domains, consistent with its role in facilitating mercury transport across cellular membranes.

Transmembrane Topology and Functional Domains

MerT is a transmembrane protein with a molecular weight of approximately 116 kDa . Its structure encompasses multiple transmembrane segments that span the bacterial cell membrane, creating a pathway for mercury ions to move from the periplasmic space into the cytoplasm. The protein's topology is arranged to optimize interactions with both mercury ions and other components of the mercury transport system.

The transmembrane arrangement of merT features strategic positioning of cysteine residues, which are crucial for its function. These cysteine residues form coordination sites for binding mercury ions (Hg²⁺), facilitating their passage through the membrane. The protein accomplishes mercury transport through these interactions with cysteine residues and by folding into energetically favorable conformations that promote ion movement .

Functional Mechanisms of merT in Mercury Transport

The merT protein operates as part of a sophisticated system for mercury detoxification in Shewanella putrefaciens and other bacteria with mercury resistance capabilities. Its primary function involves the transport of mercuric ions (Hg²⁺) from the periplasm into the cytoplasm, where these ions can be processed by other components of the mercury resistance system.

Mercury Binding and Transport Process

The transport mechanism of merT centers on the protein's ability to bind mercury ions through interactions with its cysteine residues. These residues provide sulfhydryl groups that have a high affinity for mercury, creating binding sites that temporarily sequester the toxic ions. The protein undergoes conformational changes upon mercury binding, facilitating the directional movement of ions across the membrane barrier.

Experimental evidence from Zone of Inhibition tests supports the functional role of merT in mercury transport. When merT and merP are expressed in the absence of the mercuric reductase enzyme (merA), bacterial cells show increased sensitivity to mercury compounds. This increased sensitivity occurs because merT and merP efficiently transport mercury into the cell, but without merA to detoxify the ions, the accumulated mercury becomes toxic to the cells . This observation confirms that merT is actively involved in mercury transport rather than detoxification itself.

Coordination with Other Mercury Resistance Components

MerT does not function in isolation but works in concert with other proteins encoded by the mer operon. Particularly important is its coordination with merP, a periplasmic mercury-binding protein. Together, these proteins form a relay system for mercury ions:

1. MerP initially binds mercury ions in the periplasm

2. MerT receives these ions from merP and facilitates their transport across the membrane

3. In the cytoplasm, mercury ions are handed off to the mercuric reductase (merA)

4. MerA reduces toxic Hg²⁺ to less toxic elemental mercury (Hg⁰), which can diffuse out of the cell

This coordinated handoff mechanism ensures efficient processing of mercury compounds while minimizing their toxic effects on cellular components. Zone of Inhibition tests have demonstrated that merT and merP function together to transport Hg²⁺ into the cell, as their expression in the absence of merA leads to increased mercury sensitivity .

Expression and Purification of Recombinant merT

The study and application of merT protein have been significantly advanced by recombinant DNA technology, which allows for the controlled expression and purification of the protein in laboratory settings. These techniques provide researchers with access to substantial quantities of the protein for structural analysis, functional studies, and potential biotechnological applications.

Expression Systems and Methodologies

Recombinant Shewanella putrefaciens merT protein is typically expressed in Escherichia coli expression systems, which offer efficient protein production and convenient genetic manipulation. In commercial preparations, the full-length merT protein (amino acids 1-115) is often fused with affinity tags, such as histidine (His) tags, to facilitate purification .

The expression plasmids containing the merT gene are designed with appropriate promoters, ribosome binding sites, and transcription terminators to ensure efficient expression in the host organism. The genetic construct may also include regulatory elements that allow for controlled induction of protein expression, such as the lac promoter system.

Purification and Quality Assessment

After expression, the recombinant merT protein requires careful purification to remove cellular components and contaminants. The process typically involves the following steps:

1. Cell lysis to release the expressed protein

2. Affinity chromatography, often utilizing the His-tag for selective binding

3. Additional purification steps such as ion-exchange or size-exclusion chromatography

4. Quality assessment through methods such as SDS-PAGE

Commercially available recombinant merT preparations achieve purity levels greater than 90% as determined by SDS-PAGE analysis . The purified protein is typically provided in lyophilized form to ensure stability during storage and shipping.

Comparative Analysis with Other Transport Systems in Shewanella

Shewanella putrefaciens possesses multiple transport systems specialized for different substrates, including metals and other compounds. Comparing merT with these other transport systems provides insight into the diverse strategies that bacteria employ for managing environmental interactions.

Comparison with Mtr Transport System

While merT functions in mercury transport, Shewanella species also possess the Mtr system, which is involved in extracellular electron transfer. The Mtr system consists of a protein complex located on the outer membrane, including MtrA, MtrB, and MtrC proteins that transfer electrons from the cytoplasm to the exterior of the bacterial cell .

Unlike merT, which transports mercury ions inward for detoxification, the Mtr system moves electrons outward, allowing Shewanella to use external solid minerals as electron acceptors during anaerobic respiration. MtrB, like merT, is membrane-associated but serves as an anchoring protein rather than directly participating in transport. It helps locate MtrA and MtrC and increases the stability of the complex .

The contrast between these systems highlights the versatility of Shewanella's membrane transport mechanisms, adapted for different environmental challenges. While merT manages toxic compounds by internalizing them for detoxification, the Mtr system facilitates energy generation by externalizing electrons to environmental acceptors.

Biotechnological Applications and Future Perspectives

The unique properties of merT protein and its role in mercury detoxification present opportunities for various biotechnological applications, particularly in environmental remediation and biomonitoring. Understanding these potential applications provides insight into how basic research on bacterial transport systems can translate into practical solutions for environmental challenges.

Bioremediation of Mercury-Contaminated Environments

Recombinant merT protein, as part of engineered biological systems, holds promise for the remediation of environments contaminated with mercury compounds. Potential applications include:

1. Development of engineered bacteria expressing optimized merT-merP-merA systems for enhanced mercury capture and detoxification

2. Creation of bioreactors containing immobilized cells or proteins for mercury removal from industrial wastewater

3. Design of biosorbents incorporating merT protein for selective mercury binding in environmental samples

These approaches could provide more environmentally friendly alternatives to current physical and chemical methods for mercury remediation, potentially offering higher specificity and lower secondary environmental impacts.

Biosensors for Mercury Detection

The specific binding interaction between merT and mercury ions creates opportunities for developing highly sensitive and selective biosensors for environmental monitoring. Such biosensors might incorporate:

1. Recombinant merT protein conjugated with reporter systems that signal mercury binding

2. Whole-cell biosensors expressing merT linked to easily detectable output signals

3. Electrochemical sensors utilizing immobilized merT for mercury detection

These biosensing technologies could enable rapid, field-deployable detection methods for monitoring mercury contamination in various environmental matrices, including water, soil, and air samples.