Recombinant Shewanella putrefaciens Na (+)-translocating NADH-quinone reductase subunit D

What is Na(+)-translocating NADH-quinone reductase subunit D and what is its role in Shewanella putrefaciens?

Na(+)-translocating NADH-quinone reductase subunit D (NqrD) is a critical component of the Na(+)-NQR complex in Shewanella putrefaciens. This complex functions as a respiratory chain enzyme that couples the oxidation of NADH to the reduction of quinones while simultaneously translocating sodium ions across the membrane.

NqrD specifically contributes to the membrane-embedded portion of the Na(+)-NQR complex and is characterized by its transmembrane nature. The complete protein in S. putrefaciens (strain CN-32 / ATCC BAA-453) consists of 210 amino acids with a UniProt accession number of A4Y3Y9 . The protein is part of an electron transport system that allows S. putrefaciens to utilize various electron acceptors, contributing to its metabolic versatility.

What are the structural features of NqrD from Shewanella putrefaciens?

NqrD from Shewanella putrefaciens has the following structural characteristics:

• Complete amino acid sequence: MSDAKELKQVLTGPIVNNNPIALQILGVCSALAVTSKLETALVMALALTAVTAFSNLFISLIRNHIPSSVRIIVQMTIIASLVIVVDQLLQAYAYQISKQLSVFVGLIITNCIVMGRAEAYAMKTPPMMSFMDGIGNGLGYGVILLAVGFVRELFGNGSLFGVQILHKISEGGWYQPNGMLLLPPSAFFLIGILIWIIRTYKPEQVEAKG

• Predominantly hydrophobic transmembrane protein with multiple transmembrane domains

• Belongs to the NqrD/RnfD family of proteins

• Contains conserved domains essential for sodium ion translocation

• Functions within the Na(+)-NQR complex, interacting with other subunits (NqrA, NqrB, NqrC, NqrE, and NqrF)

The functional NqrD protein embeds within the bacterial membrane, where it participates in creating a sodium ion channel for translocation coupled to electron transport.

How does the NqrD subunit contribute to electron transfer in Shewanella species?

The NqrD subunit works as part of the complete Na(+)-NQR complex to transfer electrons from NADH to quinones. While not directly involved in NADH binding or oxidation, NqrD plays a crucial role in the electron transfer pathway and sodium translocation mechanism.

In Shewanella species, electron transfer systems are particularly important due to their diverse respiratory capabilities. Research suggests that Na(+)-NQR complex functions in coordination with other electron transfer systems. For example, in S. oneidensis MR-1, deletion of all four NADH dehydrogenases (NDHs) still permits growth under fumarate-respiring conditions when utilizing N-acetylglucosamine, indicating the presence of alternative electron transport pathways .

The NqrD subunit contributes to this versatility by participating in a system that allows the bacterium to couple NADH oxidation with Na+ translocation, providing energy conservation through the generated sodium motive force.

What expression systems are recommended for producing recombinant NqrD?

For research applications requiring recombinant NqrD from Shewanella putrefaciens, several expression systems have been utilized successfully:

Table 1: Recommended Expression Systems for Recombinant NqrD

When expressing NqrD, researchers should consider:

• Using low temperature induction (16-20°C) to improve proper folding

• Including membrane-mimicking detergents in purification buffers

• Utilizing fusion tags that enhance solubility while allowing for native function post-cleavage

• Storage in Tris-based buffer with 50% glycerol is recommended for stability

How can researchers detect and quantify the activity of recombinant Na(+)-translocating NADH-quinone reductase complex?

Quantifying the activity of the Na(+)-NQR complex requires specialized assays that can measure both electron transfer and sodium translocation:

Electron Transfer Activity Assays:

• NADH oxidation assay: Monitor the decrease in absorbance at 340 nm as NADH is oxidized

• Quinone reduction assay: Measure the reduction of ubiquinone analogues (e.g., Q1 or decylubiquinone)

• Dye-coupled assays: Using electron acceptors like DCPIP (2,6-dichlorophenolindophenol)

Sodium Translocation Assays:

• Sodium-sensitive fluorescent probes (e.g., SBFI)

• 22Na+ uptake experiments with reconstituted proteoliposomes

• pH changes associated with Na+ movement

For reliable quantification, it's essential to purify the intact Na(+)-NQR complex or reconstitute the complex from purified subunits. Single subunits like NqrD typically don't show activity in isolation but must be assembled with other components of the complex.

Based on studies with related bacterial Na(+)-NQR complexes, activity is typically measured in proteoliposomes or membrane vesicles where proper orientation and membrane environment can be maintained.

What relationships exist between Na(+)-NQR activity and other electron transport systems in Shewanella species?

The Na(+)-NQR complex operates as part of a sophisticated network of electron transport systems in Shewanella species. Research has revealed several important relationships:

• Complementary function with NADH dehydrogenases: In S. oneidensis MR-1, studies have shown that deletion of all four NADH dehydrogenases still permits anaerobic growth on N-acetylglucosamine with fumarate as electron acceptor. This indicates redundancy in electron transfer pathways .

• Interaction with d-lactate metabolism: The LdhA-Dld system (d-lactate dehydrogenase) serves as a bypass of NADH dehydrogenases in electron transfer, suggesting a relationship between Na(+)-NQR and alternative electron transfer pathways .

• Role in maintaining redox balance: Na(+)-NQR likely contributes to maintaining appropriate NADH/NAD+ ratios, which affects various cellular processes in bacteria. This is particularly important under electron acceptor-limited conditions .

• Contribution to extracellular electron transfer: Shewanella species are known for their ability to transfer electrons to external acceptors, including metals and electrodes. The Na(+)-NQR complex may indirectly support these processes by managing intracellular redox balance.

This complex interplay among electron transport systems provides Shewanella species with remarkable metabolic flexibility, allowing them to thrive in diverse environments with varying electron acceptors.

How does the Na(+)-NQR complex contribute to Shewanella's potential applications in bioelectrochemical systems?

The Na(+)-NQR complex plays a significant role in the potential applications of Shewanella species in bioelectrochemical systems (BESs), though this connection is often overlooked in research:

• Energy conservation and electron flow management: The Na(+)-NQR complex contributes to cellular energy conservation through coupling NADH oxidation with Na+ translocation. This energy management is crucial for optimal performance in BESs.

• Redox balance maintenance: Proper functioning of electron transfer systems, including Na(+)-NQR, helps maintain appropriate redox balance in the cell. Genome-scale metabolic models of S. oneidensis MR-1 have identified numerous metabolic engineering targets to improve electricity production .

• Substrate utilization efficiency: The Na(+)-NQR complex may influence how efficiently Shewanella species utilize various carbon sources. Simulation studies suggest that expanding the substrate spectrum of S. oneidensis MR-1 to highly reduced feedstocks, such as glucose and glycerol, would be beneficial for electron generation in microbial fuel cells .

• Potential engineering target: While not directly identified in the genome-scale metabolic model iLJ1162, the Na(+)-NQR complex interacts with pathways that have been identified as engineering targets, such as those involving NADH regeneration, the serine cycle, and the pentose phosphate pathway .

Understanding and potentially engineering the Na(+)-NQR complex could contribute to improving electron generation rates in BESs, addressing a critical bottleneck in their industrial application.

What genetic engineering approaches can be used to study or modify NqrD in Shewanella putrefaciens?

Recent advances in genetic tools for Shewanella species have expanded the options for studying and modifying NqrD:

• Prophage-mediated genome engineering (recombineering): A λ Red Beta homolog from Shewanella sp. W3-18-1 has been utilized for precise genome editing. This system allows for markerless mutations with approximately 5% recombination efficiency among total cells .

• Electroporation-based transformation: A robust electroporation method has been developed for S. oneidensis with efficiency of approximately 4.0 × 10^6 transformants/μg DNA. This method maintains high transformation efficiency even when cells are frozen for long-term storage .

• Site-directed mutagenesis strategies: For studying specific amino acid residues in NqrD, site-directed mutagenesis using single-strand DNA oligonucleotides has been demonstrated in Shewanella species .

• Expression vector systems: Various expression vectors compatible with Shewanella species have been developed, allowing for controlled expression of native or modified NqrD.

Table 2: Comparison of Genetic Engineering Approaches for NqrD Modification

These approaches enable researchers to create NqrD variants, study structure-function relationships, and potentially engineer enhanced versions for biotechnological applications.

What protocols are most effective for purifying recombinant NqrD while maintaining its native conformation?

Purifying membrane proteins like NqrD presents unique challenges that require specialized approaches:

Step 1: Cell Lysis and Membrane Isolation

• French press or sonication in buffer containing protease inhibitors

• Differential centrifugation to isolate membrane fractions (typically 100,000×g ultracentrifugation)

• Washing of membrane pellets to remove peripheral proteins

Step 2: Membrane Protein Solubilization

• Selection of appropriate detergents: n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS at concentrations just above their critical micelle concentration

• Incubation with gentle agitation (4°C, 1-2 hours)

• Removal of insoluble material by ultracentrifugation

Step 3: Affinity Purification

• Immobilized metal affinity chromatography (IMAC) for His-tagged NqrD

• Careful selection of imidazole concentrations to minimize non-specific binding while maximizing yield

• Optional secondary affinity step (e.g., anti-FLAG, Strep-tag) for higher purity

Step 4: Size Exclusion Chromatography

• Final purification step to separate aggregates and ensure homogeneity

• Buffer typically containing low detergent concentration to maintain solubility

Storage Conditions:

• Tris-based buffer with 50% glycerol at -20°C is recommended

• For extended storage, -80°C is preferable

• Avoid repeated freeze-thaw cycles

Quality Control Measures:

• SDS-PAGE with Coomassie staining and western blotting

• Mass spectrometry to confirm identity and integrity

• Circular dichroism to assess secondary structure

How can researchers effectively study the interaction between NqrD and other subunits of the Na(+)-NQR complex?

Understanding the interactions between NqrD and other subunits of the Na(+)-NQR complex requires a combination of biochemical, biophysical, and structural approaches:

Co-immunoprecipitation and Pull-down Assays:

• Using tagged versions of NqrD to identify interacting partners

• Crosslinking approaches to stabilize transient interactions

• Quantitative analysis of binding affinities using surface plasmon resonance (SPR)

Reconstitution Studies:

• Stepwise reconstitution of the Na(+)-NQR complex from purified components

• Functional assays to determine the minimum components required for activity

• Proteoliposome reconstitution to study functionality in a membrane environment

Structural Biology Approaches:

• Cryo-electron microscopy of the intact complex

• X-ray crystallography of subcomplexes

• Nuclear magnetic resonance (NMR) for dynamic studies of smaller components

Computational Methods:

• Molecular docking to predict interaction interfaces

• Molecular dynamics simulations to study conformational changes

• Sequence conservation analysis to identify critical interaction motifs

Mutagenesis Studies:

• Alanine scanning of potential interaction interfaces

• Charge reversal mutations to disrupt salt bridges

• Creation of chimeric proteins to map interaction domains

The combination of these approaches provides a comprehensive understanding of how NqrD integrates into the functional Na(+)-NQR complex and contributes to its electron transfer and ion translocation activities.

What approaches are most effective for measuring Na+ translocation activity associated with the Na(+)-NQR complex?

Measuring Na+ translocation by the Na(+)-NQR complex requires sophisticated techniques to detect ion movements across membranes. The following methodologies are recommended:

1. Fluorescent Probe-Based Measurements:

• Sodium-sensitive fluorescent indicators (e.g., SBFI, CoroNa Green)

• Monitoring fluorescence changes in response to Na+ concentration shifts

• Can be performed with intact cells, membrane vesicles, or reconstituted proteoliposomes

2. Radioisotope Flux Measurements:

• Using 22Na+ to directly track sodium ion movement

• Time-course measurements of uptake or efflux

• Requires careful controls to account for passive diffusion

3. Electrophysiological Approaches:

• Solid-supported membrane (SSM)-based electrophysiology

• Patch-clamp techniques adapted for bacterial systems

• Direct measurement of electrical currents associated with Na+ movement

4. pH Monitoring Methods:

• Measuring pH changes coupled to Na+ movement (using pH-sensitive dyes)

• Particularly useful when Na+ translocation is coupled to proton movements

5. Reconstitution Systems:

• Purified Na(+)-NQR complex reconstituted into proteoliposomes

• Control over internal and external buffer composition

• Ability to establish defined gradients and potentials

Experimental Design Considerations:

• Include ionophore controls (e.g., monensin) to dissipate Na+ gradients

• Vary NADH concentrations to establish dose-response relationships

• Test pH dependence to characterize optimum conditions for activity

• Include inhibitors (e.g., HQNO, 2-n-heptyl-4-hydroxyquinoline N-oxide) to confirm specificity

These approaches provide complementary information about the Na+ translocation activity, allowing researchers to fully characterize this critical function of the Na(+)-NQR complex.

What are the challenges and solutions in characterizing the electron transfer pathway within the Na(+)-NQR complex?

Characterizing the electron transfer pathway within the Na(+)-NQR complex presents several technical challenges, but innovative solutions have been developed:

Challenges:

• Complex membrane protein nature: The Na(+)-NQR complex consists of multiple membrane-spanning subunits that are difficult to express and purify while maintaining native structure.

• Multiple cofactors: The complex contains various redox cofactors (FMN, FAD, FeS centers, riboflavin) with overlapping spectral properties.

• Rapid electron transfer: The electron transfers occur on timescales that are difficult to resolve with conventional techniques.

• Conformational changes: Electron transfer may be coupled to conformational changes that affect the pathway.

Solutions and Methodologies:

• Advanced Spectroscopy:

  • Stopped-flow spectroscopy to capture transient intermediates

  • Electron paramagnetic resonance (EPR) to characterize paramagnetic centers

  • Resonance Raman spectroscopy to examine cofactor environments

• Site-Directed Mutagenesis:

  • Systematic modification of potential electron transfer residues

  • Creation of variants with altered redox properties

  • Introduction of spectroscopic probes at specific positions

• Time-Resolved Techniques:

  • Ultrafast laser spectroscopy to monitor electron transfer in real time

  • Freeze-quench methods to trap intermediates for analysis

• Structural Studies Combined with Functional Assays:

  • Correlation of structural data with kinetic measurements

  • Computational modeling of electron tunneling pathways

  • QM/MM (quantum mechanics/molecular mechanics) approaches to calculate electron transfer rates

• Cofactor Manipulation:

  • Reconstitution with modified or isotopically labeled cofactors

  • Extraction and replacement of native cofactors

  • Introduction of artificial electron donors/acceptors

By combining these approaches, researchers can develop a comprehensive understanding of the electron transfer pathway within the Na(+)-NQR complex, including the specific role of the NqrD subunit in this process.

How does the Na(+)-NQR complex contribute to Shewanella's ability to thrive in diverse environments?

The Na(+)-NQR complex plays a significant role in Shewanella's remarkable environmental adaptability:

• Energy conservation under various conditions: By coupling NADH oxidation to Na+ translocation, the Na(+)-NQR complex provides an energy conservation mechanism that functions effectively under various environmental conditions, including those with limited oxygen availability.

• Support for respiratory flexibility: Shewanella species are known for their ability to utilize a diverse array of electron acceptors. The Na(+)-NQR complex contributes to the electron transport network that enables this respiratory flexibility, particularly under anaerobic conditions.

• Adaptation to marine environments: Many Shewanella species inhabit marine environments where Na+ concentrations are high. The Na(+)-NQR complex allows these bacteria to exploit this abundant ion for bioenergetic purposes.

• Role in redox balance maintenance: The Na(+)-NQR complex contributes to maintaining appropriate NADH/NAD+ ratios under varying environmental conditions, which affects numerous cellular processes in bacteria .

• Support for alternative carbon source utilization: While Shewanella species are known to preferentially utilize low-molecular-weight organic acids like lactate, they can also metabolize other carbon sources, including N-acetylglucosamine (NAG), a major component of chitin that is abundant in natural environments . The Na(+)-NQR complex may contribute to the electron transfer processes required for metabolizing these alternative carbon sources.

This metabolic versatility, supported in part by the Na(+)-NQR complex, allows Shewanella species to colonize diverse ecological niches and adapt to changing environmental conditions.

What is the potential of targeting the Na(+)-NQR complex for antibacterial development against Shewanella infections?

The Na(+)-NQR complex represents a potential target for developing antibacterial strategies against Shewanella infections:

• Increasing clinical significance: Shewanella species are emerging pathogens that can cause severe hepatobiliary, skin and soft tissue, gastrointestinal, and respiratory infections, as well as bacteremia . A large case series of 128 patients with Shewanella infections identified hepatobiliary diseases (63.3%), malignancy (26.6%), chronic kidney disease (25.8%), and diabetes mellitus (22.7%) as common underlying conditions .

• Unique bacterial target: The Na(+)-NQR complex is found in various bacteria but is absent in mammalian cells, making it a potentially selective target for antibacterial development.

• Essential metabolic function: Inhibition of the Na(+)-NQR complex could disrupt bacterial energy metabolism, particularly under conditions where this complex plays a significant bioenergetic role.

• Known inhibitors as starting points: Several compounds, including 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO) and korormicin, are known to inhibit Na(+)-NQR complexes in various bacteria and could serve as starting points for drug development.

• Consideration of resistance patterns: Shewanella species display variable susceptibility to common antibiotics. S. algae and S. putrefaciens isolates are generally susceptible to ceftazidime (98.7%), gentamicin (97.4%), and cefoperazone-sulbactam (93.5%), but only 76.6% of isolates are susceptible to imipenem-cilastatin . Targeting the Na(+)-NQR complex could provide an alternative approach for strains with resistance to conventional antibiotics.

Development of Na(+)-NQR inhibitors would require careful optimization to achieve appropriate selectivity, pharmacokinetics, and safety profiles, but the complex represents a promising target for novel antibacterial strategies.

How can genetic engineering of the Na(+)-NQR complex enhance Shewanella's applications in bioelectrochemical systems?

Genetic engineering of the Na(+)-NQR complex holds promise for enhancing Shewanella's applications in bioelectrochemical systems (BESs):

Recent advances in genetic engineering tools for Shewanella, including electroporation methods with high transformation efficiency (~4.0 × 10^6 transformants/μg DNA) and prophage-mediated genome engineering systems, provide the technical foundation for implementing these engineering strategies .

What role could the Na(+)-NQR complex play in synthetic biology applications of Shewanella species?

The Na(+)-NQR complex offers several opportunities for synthetic biology applications involving Shewanella species:

• Designer bioenergetic systems: The Na(+)-NQR complex could be engineered to create bacteria with customized bioenergetic properties, such as altered Na+/e- stoichiometry or modified regulatory responses, for specific biotechnological applications.

• Biosensors for environmental monitoring: Engineered Shewanella strains with modified Na(+)-NQR complexes could serve as biosensors for environmental parameters, such as sodium concentration or redox conditions.

• Platform for studying membrane protein assembly: The multi-subunit nature of the Na(+)-NQR complex makes it a valuable model for studying principles of membrane protein complex assembly, which could inform broader synthetic biology efforts.

• Integration with non-native metabolic pathways: Genome-scale metabolic models of S. oneidensis have been used to simulate optimal biosynthetic pathways for platform chemicals in microbial electrosynthesis systems . The Na(+)-NQR complex could be engineered to better interface with these non-native pathways.

• Development of minimal respiratory systems: Understanding the essential components and interactions within the Na(+)-NQR complex could contribute to efforts to design minimal, efficient respiratory systems for synthetic biology applications.

• Bio-computing elements: The electron transfer and ion translocation functions of the Na(+)-NQR complex could potentially be repurposed as components of biological computing systems, where electron flow represents computational processes.

These applications would benefit from the recently developed genetic tools for Shewanella species, including precise genome editing methods and high-efficiency transformation protocols .