Recombinant Shewanella putrefaciens Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
kdpC; Sputcn32_3080; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Target Names
kdpC
Target Protein Sequence
MNSIVYTTKTQHAVMGLRASLALLFVCGVVYTGTVTQLGGALFPAQAKGSVIHRDNVAMG SEFIAQPFVNPAYFYSRPSAVDYDPMATGGSNLAPSNPALRERVMATSQEIQARESVQAA DIPVDLLATSGAGLDPHISPAAAKLQVARVAQARQLAEPQVLTLVAQFIEPPQWGIFGQA RVNVLKLNLALDQIAKHAQ
Uniprot No.

Target Background

Function
The Recombinant *Shewanella putrefaciens* Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by forming a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Shewanella putrefaciens and why is its kdpC protein significant for research?

Shewanella putrefaciens is a gram-negative, facultatively anaerobic, rod-shaped bacterium notable for its diverse respiratory capabilities. It can use various electron acceptors including Fe(III), Mn(IV), trimethylamine N-oxide (TMAO), elemental sulfur, nitrate, thiosulfate, and fumarate during anaerobic respiration . S. putrefaciens has both environmental importance due to its metal-reducing abilities and clinical relevance as an opportunistic pathogen in certain conditions .

The kdpC protein is significant because it forms part of the KdpFABC complex, an essential high-affinity potassium uptake system that helps bacteria maintain potassium homeostasis under low-potassium conditions. As potassium is crucial for bacterial turgor pressure, pH regulation, and membrane potential, the KdpFABC complex represents an important adaptive mechanism for bacterial survival in potassium-limited environments .

What is the basic structure and function of the KdpFABC complex in which kdpC operates?

The KdpFABC complex is a unique oligomeric K+ transport system that combines structural elements from two different protein superfamilies:

  • A channel-like subunit (KdpA) from the superfamily of K+ transporters

  • A pump-like subunit (KdpB) from the superfamily of P-type ATPases

  • Supporting subunits KdpC and KdpF that provide stability and potentially regulatory functions

The C chain (kdpC) specifically appears to function similarly to β subunits of Na+/K+ ATPase and gastric H+ ATPase, potentially increasing K+ affinity . KdpC's position near the selectivity filter suggests it may enhance the complex's ability to recognize and transport potassium ions with high specificity.

How does the KdpFABC complex differ from other potassium transport systems?

The KdpFABC complex represents a unique evolutionary partnership between proteins descended from different superfamilies, making it distinct from other potassium transport systems. Key differences include:

FeatureKdpFABCOther K+ Transport Systems
StructureHybrid complex with channel-like and pump-like componentsTypically either channels or transporters, not both
Energy SourceATP hydrolysis (via KdpB)Often use ion gradients or membrane potential
AffinityHigh-affinity system (operates at very low external K+ concentrations)Variable affinity depending on the specific system
ExpressionInduced when external potassium is limitedMany are constitutively expressed
Transport MechanismProposed mechanism involving both KdpA and KdpB subunitsDirect channel or transporter mechanisms

This unique structure allows bacteria to maintain potassium homeostasis even when environmental potassium levels are as low as 10^-4 of intracellular concentrations .

How is the transport mechanism of potassium ions achieved through the KdpFABC complex?

The transport mechanism of potassium through the KdpFABC complex appears to be more complex than initially thought. Recent structural studies suggest:

  • Potassium ions enter through the selectivity filter in KdpA

  • Instead of passing through KdpA completely, the ions are redirected through an intramembrane tunnel

  • The ions reach binding sites in the membrane domain of KdpB

  • ATP hydrolysis drives conformational changes in KdpB that facilitate K+ transfer between alternative sites

  • Eventually, K+ reaches a low-affinity site where a water-filled pathway allows release to the cytoplasm

This mechanism represents a unique hybrid approach where the selectivity of an ion channel is combined with the energy-coupling of a P-type ATPase, allowing for active transport against steep concentration gradients. The model suggests "the ion channel pore remains closed and potassium ions are redirected through the P-type ATPase subunit," which helps explain how the complex can pump potassium against concentration gradients as high as 10^4 .

What experimental evidence clarifies the specific contribution of kdpC to potassium transport?

While direct experimental evidence specifically for kdpC's role is limited in the available literature, several observations suggest its importance:

  • KdpC's position near the selectivity filter indicates a potential role in ion recognition or channel gating

  • The lack of conformational changes in KdpC during the transport cycle suggests a structural or regulatory role rather than direct involvement in the mechanical aspects of transport

  • Researchers have speculated that KdpC may function like β subunits in other P-type ATPases, which are known to increase ion affinity

Further research using site-directed mutagenesis of kdpC residues and functional assays would be valuable to definitively determine its specific contributions to potassium transport.

What expression systems are most effective for producing recombinant kdpC protein for structural studies?

Based on current practices in membrane protein research, effective expression systems for recombinant kdpC would likely include:

  • E. coli-based expression systems: Common for bacterial proteins, with options including:

    • BL21(DE3) strains with T7 promoter-based vectors

    • C41/C43 strains specifically designed for membrane protein expression

    • Tunable expression systems using arabinose or rhamnose inducible promoters

  • Expression tags and fusion partners:

    • N-terminal or C-terminal His-tags for purification

    • Fusion partners such as MBP (maltose-binding protein) or SUMO to enhance solubility

    • Specific protease cleavage sites for tag removal

  • Membrane protein-specific considerations:

    • Co-expression with other KdpFABC components may be necessary for proper folding

    • Expression at lower temperatures (16-25°C) to slow production and aid folding

    • Use of specialized media formulations to enhance membrane protein yields

The exact approach would need to be optimized experimentally, as no single system works universally for all membrane proteins.

How can researchers effectively isolate and purify recombinant kdpC for functional and structural studies?

Purification of recombinant kdpC would likely involve the following steps:

  • Membrane extraction:

    • Gentle cell lysis (sonication, homogenization, or enzymatic methods)

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using appropriate detergents (e.g., DDM, LMNG, or amphipols)

  • Chromatography techniques:

    • Immobilized metal affinity chromatography (IMAC) using His-tags

    • Size exclusion chromatography for further purification and buffer exchange

    • Ion exchange chromatography if needed for additional purification

  • Specialized approaches for structural studies:

    • Detergent screening to identify optimal conditions for stability

    • Reconstitution into lipid nanodiscs or liposomes for functional studies

    • Buffer optimization for cryo-EM or crystallization trials

  • Quality control assessments:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Circular dichroism to verify secondary structure integrity

    • Dynamic light scattering to assess homogeneity

For comprehensive structural studies, it may be necessary to purify the entire KdpFABC complex rather than kdpC alone to maintain proper folding and functional integrity.

What methods can researchers use to measure the functional activity of kdpC within the KdpFABC complex?

Several complementary approaches can be used to assess kdpC function:

  • In vivo potassium uptake assays:

    • Growth complementation in K+-uptake deficient strains

    • Radioactive 86Rb+ uptake measurements (Rb+ serves as a K+ analog)

    • Intracellular K+ concentration measurements using flame photometry or ion-selective electrodes

  • In vitro ATPase activity measurements:

    • Colorimetric assays measuring phosphate release

    • Coupled enzyme assays linking ATP hydrolysis to NADH oxidation

    • ATP hydrolysis measured by HPLC

  • Biophysical characterization:

    • Isothermal titration calorimetry (ITC) to measure K+ binding affinities

    • Surface plasmon resonance (SPR) for interaction studies

    • Electrophysiological measurements in reconstituted systems

  • Structural dynamics:

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational changes

    • FRET-based approaches to monitor protein dynamics during transport

    • EPR spectroscopy with site-directed spin labeling

How does kdpC function relate to Shewanella putrefaciens' unique ability to use alternative electron acceptors?

Shewanella putrefaciens is known for its remarkable respiratory versatility, capable of using various electron acceptors including Fe(III), Mn(IV), TMAO, elemental sulfur, nitrate, and fumarate . The relationship between kdpC function and this respiratory versatility presents an intriguing research area:

  • Potassium homeostasis and energy metabolism:

    • Maintaining appropriate K+ concentrations is crucial for membrane potential, which impacts electron transport chain function

    • KdpFABC activation under K+-limited conditions may influence respiratory pathway selection

  • Gene regulation networks:

    • There may be coordinated regulation between potassium homeostasis systems and respiratory pathways

    • Environmental signals that trigger expression of different respiratory pathways might also affect kdpC expression

  • Adaptation to diverse environments:

    • S. putrefaciens thrives in transition zones between aerobic and anaerobic environments

    • The high-affinity KdpFABC system may be particularly important in these ecological niches where nutrients including K+ may be limited

Studies examining kdpC expression and KdpFABC complex activity under different respiratory conditions could reveal important functional relationships between potassium transport and respiratory flexibility.

What are the differences in kdpC structure and function between pathogenic and non-pathogenic Shewanella strains?

Shewanella species exhibit varying pathogenic potential. Some strains of S. putrefaciens are associated with infections, while others like strain Pdp11 have been described as probiotic for use in aquaculture . Comparing kdpC across these strains may reveal important insights:

  • Genomic comparisons:

    • Some pathogenic strains of S. putrefaciens contain plasmids that are absent in probiotic strains

    • While current evidence doesn't specifically link these plasmids to kdpC, plasmid-based genetic elements could potentially influence kdpC expression or function

  • Expression patterns:

    • Pathogenic and non-pathogenic strains may differ in how they regulate kdpC expression in response to environmental signals

    • These differences could influence adaptability to host environments

  • Protein sequence variations:

    • Single amino acid polymorphisms in kdpC might affect protein-protein interactions within the KdpFABC complex

    • Such variations could impact transport efficiency or regulatory properties

  • Host environment adaptation:

    • Potassium availability varies in different host environments

    • Pathogenic strains may have evolved specialized regulation of potassium transport systems to thrive in specific host niches

This comparative approach could potentially identify kdpC-related factors that contribute to pathogenicity or probiotic properties in different Shewanella strains.

How does environmental potassium concentration influence expression and function of the KdpFABC complex in Shewanella putrefaciens?

The KdpFABC complex is typically expressed under conditions of potassium limitation. In Shewanella putrefaciens, this regulatory response likely involves sophisticated sensing mechanisms:

  • Transcriptional regulation:

    • The kdp operon is likely regulated by a two-component system similar to KdpD/KdpE in E. coli

    • Environmental K+ concentrations would be sensed by a membrane-associated kinase that phosphorylates a response regulator

  • Environmental adaptation mechanisms:

    • Low temperature has been shown to affect S. putrefaciens metabolism and gene expression

    • The interplay between temperature, potassium availability, and kdp expression represents an important research question

  • Energetic considerations:

    • The ATP-driven KdpFABC system requires significant energy investment

    • Under energy-limited conditions, there may be complex regulatory decisions between expressing KdpFABC versus alternative, less energy-intensive transporters

Research measuring kdpC expression levels and KdpFABC activity across various potassium concentrations and environmental conditions would provide valuable insights into these regulatory mechanisms.

How should researchers approach contradictory data regarding KdpFABC transport mechanisms?

The literature contains some contradictory findings regarding the KdpFABC transport mechanism. For example, there is debate about whether the transport cycle follows the classical P-type ATPase mechanism or an alternative model . When encountering such contradictions, researchers should:

  • Critically evaluate methodological differences:

    • Different experimental systems (in vivo vs. in vitro)

    • Variation in protein constructs (full complex vs. individual subunits)

    • Different measurement techniques and their limitations

  • Consider species-specific variations:

    • Most detailed studies have been performed on E. coli KdpFABC

    • S. putrefaciens KdpFABC may have unique properties or regulatory mechanisms

  • Integrate structural and functional data:

    • Structural studies alone cannot definitively establish mechanism

    • Functional studies may miss structural nuances

    • Combined approaches provide the most comprehensive understanding

  • Design decisive experiments:

    • Identify key predictions that distinguish competing models

    • Develop experiments specifically targeting these discriminating features

    • Use complementary approaches to address the same question

When presenting results, researchers should acknowledge existing contradictions in the literature and explicitly address how their findings relate to previous models.

What are common technical challenges in working with recombinant kdpC and how can they be addressed?

Membrane proteins like kdpC present several technical challenges:

  • Expression issues:

    • Challenge: Low expression yields or inclusion body formation

    • Solution: Optimize expression conditions (temperature, induction time, media composition), try fusion tags that enhance solubility, or explore alternative expression systems

  • Purification difficulties:

    • Challenge: Protein instability after detergent extraction

    • Solution: Screen multiple detergents, add stabilizing agents (glycerol, specific lipids), or consider native nanodiscs

  • Functional assays:

    • Challenge: Isolated kdpC may not maintain native conformation

    • Solution: Consider co-expression with other KdpFABC components or reconstitution into proteoliposomes

  • Structural analysis:

    • Challenge: Obtaining sufficient quantities of properly folded protein

    • Solution: Optimize buffer conditions, explore different construct designs, consider fusion partners that promote crystallization

  • Activity measurement:

    • Challenge: Distinguishing kdpC's specific contribution within the complex

    • Solution: Develop assays comparing wild-type complex with kdpC variants or use techniques like HDX-MS to probe specific interactions

Understanding these common challenges can help researchers design more effective experimental strategies from the outset.

How can researchers integrate knowledge discovery techniques to advance understanding of kdpC function?

Knowledge discovery in databases (KDD) techniques can be valuable for generating new hypotheses about kdpC function:

  • Data preprocessing approaches:

    • Data cleaning to handle missing values and outliers

    • Data transformation to reduce dimensionality and select useful features

  • Application of data mining methods:

    • Classification techniques to identify patterns in experimental data

    • Association rule discovery to find relationships between variables

    • Clustering to identify groups of proteins with similar properties

  • Computational modeling approaches:

    • Molecular dynamics simulations to study kdpC dynamics

    • Homology modeling to predict effects of mutations

    • Systems biology approaches to integrate kdpC function with cellular networks

  • Knowledge consolidation strategies:

    • Visualization techniques to present complex findings

    • Integration of results from multiple data sources

    • Iterative refinement of models based on new experimental data

By following a structured KDD process, researchers can effectively manage the complexity of data related to membrane transport systems and generate testable hypotheses about kdpC function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.