Recombinant Shewanella putrefaciens Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to UbiB and Shewanella putrefaciens

UbiB belongs to the protein kinase-like (PKL) superfamily, a diverse group of proteins performing critical roles in numerous biological processes. The UbiB family is highly conserved across all domains of life and has been linked to essential metabolic functions . In bacteria, UbiB demonstrates ATPase activity and participates specifically in the aerobic pathway of ubiquinone biosynthesis .

Shewanella putrefaciens is a gram-negative bacterium found predominantly in aquatic environments. This species exhibits remarkable diversity, with different strains displaying either pathogenic effects toward fish or probiotic properties beneficial for aquaculture . The probiotic strain S. putrefaciens Pdp11, for example, has been extensively studied for its applications in aquaculture systems .

The recombinant expression of UbiB from S. putrefaciens offers valuable opportunities for investigating this protein's role in bacterial adaptation to varying oxygen conditions, potentially providing insights into the metabolic versatility that enables this species to thrive in diverse ecological niches.

Functional Role of UbiB in Ubiquinone Biosynthesis

Ubiquinone (coenzyme Q) serves as a critical electron carrier in the respiratory chain, making it essential for bacterial energy metabolism. The biosynthesis of ubiquinone involves a complex series of enzymatic reactions that modify the aromatic ring of the precursor molecule, 4-hydroxybenzoic acid (4-HB) .

Enzymatic Steps in Ubiquinone Biosynthesis

The biosynthetic pathway for ubiquinone involves multiple distinct chemical modifications, with UbiB playing a key accessory role:

Reaction TypeNumber of ReactionsKey Enzymes Involved
Prenylation1UbiA
Decarboxylation1UbiD, UbiX
Hydroxylation3UbiI, UbiH, UbiF (O₂-dependent) or UbiU, UbiV (O₂-independent)
Methylation3UbiG, UbiE

UbiB functions as an accessory factor in the ubiquinone biosynthetic pathway, with research demonstrating its ATPase activity is essential for specific steps in this process . Importantly, UbiB appears to be specifically involved in the oxygen-dependent pathway of ubiquinone biosynthesis. Deletion studies in E. coli have shown that strains lacking the ubiB gene produce only limited amounts of ubiquinone under aerobic conditions and none under anaerobic conditions .

Oxygen-dependent and Oxygen-independent Pathways

A significant advancement in understanding bacterial metabolism has been the discovery of dual pathways for ubiquinone biosynthesis in many proteobacteria:

CharacteristicO₂-Dependent PathwayO₂-Independent Pathway
Key ProteinsUbiB, UbiJ, UbiKUbiT, UbiU, UbiV
Oxygen RequirementUses O₂ as substrateFunctions without O₂
Environmental ConditionsAerobicBoth aerobic and anaerobic
Hydroxylation MechanismDirect incorporation of oxygenIron-sulfur cluster-dependent

This dual-pathway system represents a remarkable metabolic adaptation that allows proteobacteria to synthesize ubiquinone across the entire spectrum of oxygen conditions, from fully aerobic to anaerobic environments . This flexibility likely contributes to the ecological versatility of species like Shewanella putrefaciens, allowing them to colonize environments with varying or fluctuating oxygen levels.

Recombinant Expression and Purification of UbiB

The recombinant expression of UbiB provides valuable research tools for investigating its structure and function. Based on established methods for S. oneidensis UbiB, similar approaches could be applied to S. putrefaciens UbiB.

Expression Systems and Methods

Recombinant UbiB from Shewanella species is typically expressed in E. coli systems. For example, full-length S. oneidensis UbiB protein (amino acids 1-549) can be efficiently expressed with an N-terminal His tag in E. coli . This approach enables the production of sufficient quantities of protein for biochemical and structural studies.

Studying Bacterial Metabolism and Adaptation

Recombinant UbiB represents an invaluable tool for investigating ubiquinone biosynthesis, a critical pathway in bacterial energy metabolism. Research into UbiB function provides insights into how bacteria like S. putrefaciens adapt their metabolism to different oxygen conditions .

The discovery that many proteobacteria possess both oxygen-dependent (involving UbiB) and oxygen-independent pathways for ubiquinone biosynthesis highlights their remarkable metabolic flexibility . This adaptation enables bacteria to synthesize essential ubiquinone across diverse environmental conditions, contributing to their ability to colonize varied ecological niches.

Implications for Bacterial Pathogenicity and Probiotic Properties

Different strains of S. putrefaciens exhibit distinct phenotypic characteristics:

Strain TypeCharacteristicsPlasmid PresencePotential Relevance to UbiB
PathogenicHarmful to fishFound in two of five pathogenic strainsMay influence metabolic fitness under specific oxygen conditions
Probiotic (e.g., Pdp11)Beneficial for aquacultureNot detectedCould affect adaptation to host environments
SaprophyticNeither harmful nor beneficialNot detectedLikely related to environmental adaptation

While the search results do not establish a direct connection between UbiB and the pathogenic or probiotic properties of S. putrefaciens, the protein's central role in energy metabolism could indirectly influence bacterial fitness and host interactions . Recent research has linked bacterial adaptations to varying oxygen levels with antibiotic resistance, virulence, and colonization of complex ecosystems such as the microbiota .

Tool Development for PKL Superfamily Research

UbiB belongs to the protein kinase-like (PKL) superfamily, which includes more than 500 human proteins performing critical roles in diverse biological processes . Many members of this superfamily, including UbiB proteins, remain understudied despite their biological importance.

The development of molecular tools for studying these proteins, including recombinant expression systems and small molecule modulators, represents an important research frontier. Such tools promise to accelerate our understanding of PKL protein functionality and potentially expand opportunities for therapeutic interventions targeting this superfamily .

Small Molecule Modulation of UbiB Proteins

Recent research has focused on developing chemical tools to investigate UbiB family proteins. Studies on COQ8, described as an "archetypal UbiB member," have aimed to develop both inhibitor and activator molecules to probe function .

Approaches to Small Molecule Development

Research strategies have included:

  1. Crystal structure-guided molecular design to identify potential binding sites

  2. Activity assays to assess functional effects of candidate molecules

  3. Cellular coenzyme Q measurements to evaluate biological impacts

  4. Repurposing existing molecular scaffolds (notably 4-anilinoquinoline) to selectively inhibit UbiB proteins

One particular achievement has been the repurposing of the 4-anilinoquinoline scaffold to selectively inhibit human COQ8A, a UbiB family member, in cellular systems . The development of such selective inhibitors provides valuable tools for dissecting the specific functions of UbiB proteins.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for specific delivery timelines.
Note: Our standard shipping includes blue ice packs. If dry ice is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles should be avoided. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life can be influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please let us know, and we will prioritize its development.
Synonyms
ubiB; Sputcn32_0504; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Target Names
ubiB
Target Protein Sequence
MTLTSIRRGYHVIKTLLQYGLDEVLPPKMTPWYFTLARSSLFWIRNKHKSKPGGERLKLA MQELGPVYIKLGQMLSTRRDLLSDEWAIELAMLQDKVPPFDGVLARKAIEAELKASIESL FDDFDETPLASASISQVHTATLKSNGKAVVLKVLRPNVEAKILADLQLMSQTANLLEYFL GEGNRLRPAEVIEDYRVTILGELNLKLEALNAIKLRNNFLNSDALYVPYVYEEFCYPRLM VMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHADMHPGNIFISRDHP ENPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYIESGWVSEKTDLQAFEQ AIKVVCEPMFNKPLDEISFGHVLLELFRTARSFDIVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFPELIYDNLKLGRKLLSS QQQMLDKYLKHQQQAHKSNYMLITSAVLLICGTLLFNQDATLWSPYVCLTSGVLMWFIGW RSRPKNRKF
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which plays a role in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiB and what is its role in ubiquinone biosynthesis?

UbiB is a protein essential for ubiquinone (Coenzyme Q) biosynthesis in bacteria. It functions in the first monooxygenase step of the ubiquinone biosynthetic pathway. In Escherichia coli, it has been identified that UbiB is required specifically for this initial monooxygenase reaction in CoQ synthesis . The protein is part of a larger operon containing ubiE, yigP, and ubiB genes, which collectively contribute to the ubiquinone biosynthetic pathway . In Shewanella species, UbiB is classified as a "probable ubiquinone biosynthesis protein" or "probable protein kinase UbiB," suggesting conserved functional roles across different bacterial species .

What are the structural characteristics of recombinant Shewanella UbiB proteins?

Recombinant Shewanella UbiB proteins are typically expressed as full-length proteins with N-terminal His-tags to facilitate purification. For example, the Shewanella oneidensis UbiB protein consists of 549 amino acids (full-length 1-549) . Similarly, the Shewanella pealeana UbiB protein is also 549 amino acids in length . Both proteins show characteristic amino acid sequences expected for UbiB family proteins, which can be confirmed through sequence analysis. When comparing the amino acid sequences between these species, there are both conserved regions (likely reflecting functional domains) and variable regions (potentially representing species-specific adaptations) .

How does the ubiquinone biosynthesis pathway function in Shewanella species?

Shewanella species, being facultative anaerobes, likely possess both O₂-dependent and O₂-independent pathways for ubiquinone biosynthesis. Recent research has revealed that many proteobacteria have developed a novel O₂-independent pathway for ubiquinone biosynthesis that relies on three proteins: UbiT, UbiU, and UbiV . In this pathway, UbiT contains an SCP2 lipid-binding domain and likely functions as an accessory factor, while UbiU and UbiV form a heterodimer acting as O₂-independent hydroxylases, with each protein binding a 4Fe-4S cluster via conserved cysteines that are essential for activity . The presence of both O₂-dependent and O₂-independent pathways allows these bacteria to synthesize ubiquinone across the entire oxygen range, optimizing their metabolism under various environmental conditions .

What expression systems are recommended for producing recombinant Shewanella UbiB proteins?

For recombinant expression of Shewanella UbiB proteins, E. coli expression systems have been successfully employed. Both Shewanella oneidensis and Shewanella pealeana UbiB proteins have been expressed in E. coli with N-terminal His-tags . The resulting proteins typically demonstrate greater than 90% purity as determined by SDS-PAGE analysis. These expression systems allow for the production of lyophilized powder preparations that can be reconstituted for experimental use. The recombinant proteins are typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How do the O₂-dependent and O₂-independent ubiquinone biosynthesis pathways interact in Shewanella species?

The interaction between O₂-dependent and O₂-independent ubiquinone biosynthesis pathways in Shewanella represents a sophisticated metabolic adaptation. Research has shown that the O₂-independent pathway involving UbiT, UbiU, and UbiV proteins allows bacteria to synthesize ubiquinone under anaerobic conditions . The UbiU-UbiV complex functions as a novel class of O₂-independent hydroxylases containing 4Fe-4S clusters essential for activity. These proteins are widely distributed among alpha-, beta-, and gammaproteobacterial clades, including several human pathogens, indicating evolutionary conservation of this pathway .

In Shewanella species, which inhabit environments with fluctuating oxygen levels, the presence of both pathways likely enables metabolic flexibility. The coordinate regulation of these pathways would allow cells to optimize ubiquinone production based on environmental oxygen availability. This dual-pathway system may contribute to Shewanella's ability to thrive in diverse ecological niches with varying oxygen tensions and would be expected to influence electron transport chain function, energy metabolism, and stress responses .

What methodologies are recommended for functional characterization of recombinant UbiB proteins?

For functional characterization of recombinant UbiB proteins, a multi-faceted approach is recommended:

  • Enzymatic activity assays: Establish in vitro assays that measure the monooxygenase activity using synthetic or natural substrates. This may involve LC-MS detection of reaction products or coupled enzyme assays tracking cofactor oxidation/reduction.

  • Complementation studies: Transform UbiB-deficient bacterial strains with the recombinant UbiB gene to assess functional restoration of ubiquinone synthesis. Complementation can be monitored through ubiquinone quantification by HPLC or LC-MS .

  • Protein-protein interaction studies: Investigate interactions with other ubiquinone biosynthesis proteins using pull-down assays, co-immunoprecipitation, or yeast two-hybrid systems.

  • Structural biology approaches: Employ X-ray crystallography or cryo-EM to determine the three-dimensional structure of UbiB, which would provide insights into its catalytic mechanism.

  • Site-directed mutagenesis: Create point mutations in conserved residues to evaluate their contribution to protein function and identify catalytic sites.

When working with the protein, researchers should avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week. For long-term storage, addition of 5-50% glycerol and storage at -20°C/-80°C is recommended .

How does the UbiB protein from Shewanella putrefaciens compare with UbiB orthologs from other Shewanella species?

The UbiB proteins from different Shewanella species show significant sequence homology but also species-specific variations. Comparing the amino acid sequences from Shewanella oneidensis (549 aa) and Shewanella pealeana (549 aa) reveals both conserved and variable regions :

Both proteins are predicted to have similar domain organizations, including regions associated with kinase-like activity and membrane association. The conserved transmembrane segments in the C-terminal regions suggest membrane localization, which may be critical for accessing lipophilic substrates in the ubiquinone biosynthetic pathway .

While detailed experimental comparisons of enzymatic activity between these orthologs are not extensively reported in the literature, the high degree of sequence conservation suggests similar functions, with species-specific adaptations potentially relating to environmental niche optimization.

What are the challenges in purifying active recombinant UbiB proteins?

Purifying active recombinant UbiB proteins presents several technical challenges:

  • Membrane association: The C-terminal transmembrane segments in UbiB proteins can cause aggregation during expression and purification. This necessitates careful optimization of detergent types and concentrations during extraction and purification.

  • Protein folding: Ensuring proper folding of the recombinant protein, especially when expressed in heterologous systems like E. coli. The use of chaperone co-expression systems may improve folding efficiency.

  • Cofactor requirements: If UbiB requires specific cofactors for activity, these may need to be supplied during expression or reconstituted post-purification.

  • Activity preservation: Maintaining enzymatic activity throughout the purification process requires careful buffer optimization and handling procedures. Current protocols recommend storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

  • Protein yield: Balancing expression conditions to maximize yield while maintaining protein quality and activity.

To address these challenges, a systematic approach involving optimization of expression conditions, purification protocols, and activity assays is necessary. The addition of stabilizing agents like glycerol (5-50%) for long-term storage and avoiding repeated freeze-thaw cycles can help preserve activity .

How can researchers optimize heterologous expression of Shewanella UbiB in E. coli systems?

Optimizing heterologous expression of Shewanella UbiB in E. coli requires addressing several key factors:

  • Strain selection: BL21(DE3) or Rosetta strains are often preferred for expression of proteins from non-E. coli sources due to their reduced protease activity and expanded codon usage.

  • Vector design: Incorporating an N-terminal His-tag has proven effective for purification of Shewanella UbiB proteins . Consider using vectors with tunable promoters (like pET vectors with T7 promoters) to control expression levels.

  • Expression conditions: Optimize temperature, IPTG concentration, and induction time. Lower temperatures (16-25°C) and longer induction times often yield better results for complex proteins.

  • Media composition: Enriched media or auto-induction media can improve protein yields. For proteins requiring iron-sulfur clusters (which may be relevant given the role of iron-sulfur proteins in related ubiquinone biosynthesis enzymes ), supplementation with iron and cysteine may be beneficial.

  • Co-expression strategies: Consider co-expressing chaperones (GroEL/GroES, DnaK/DnaJ) to improve folding. For membrane-associated proteins like UbiB, co-expression with membrane insertion machinery may help.

The current protocols for Shewanella UbiB proteins have achieved greater than 90% purity as determined by SDS-PAGE, indicating successful expression and purification strategies .

What techniques are effective for analyzing UbiB's role in ubiquinone biosynthesis in vivo?

Several techniques are effective for analyzing UbiB's role in ubiquinone biosynthesis in vivo:

  • Gene knockout/complementation studies: Generate UbiB knockout strains and assess the impact on ubiquinone levels. Complementation with wild-type or mutant UbiB variants can confirm functional roles .

  • Metabolite profiling: Use LC-MS/MS to quantify ubiquinone and pathway intermediates in wild-type versus UbiB-deficient cells. This approach can identify the specific step catalyzed by UbiB by detecting accumulated precursors.

  • Isotope labeling: Incorporate stable isotope-labeled precursors and track their flow through the ubiquinone biosynthetic pathway using mass spectrometry.

  • In vivo protein-protein interaction studies: Employ bacterial two-hybrid systems, fluorescence resonance energy transfer (FRET), or in vivo crosslinking to identify UbiB's interaction partners.

  • Transcriptome/proteome analysis: Compare gene/protein expression profiles between wild-type and UbiB-deficient strains to identify compensatory mechanisms and regulatory networks.

  • Phenotypic characterization: Assess growth, respiration, and stress response phenotypes in UbiB-deficient strains under various oxygen conditions, leveraging Shewanella's ability to grow under different oxygen tensions .

Such approaches have been valuable in elucidating the roles of UbiB and other ubiquinone biosynthesis proteins in model organisms like E. coli, revealing that UbiB functions in the first monooxygenase step of ubiquinone biosynthesis .

How should researchers design experiments to explore the oxygen-dependent regulation of UbiB function?

Designing experiments to explore oxygen-dependent regulation of UbiB function requires a comprehensive approach that considers Shewanella's adaptation to varying oxygen levels:

  • Controlled oxygen environments: Utilize fermenters or specialized chambers that allow precise control of oxygen concentration from fully aerobic to anaerobic conditions.

  • Transcriptional analysis: Employ qRT-PCR or RNA-seq to measure UbiB transcript levels under different oxygen tensions. Include analysis of genes involved in both O₂-dependent and O₂-independent ubiquinone biosynthesis pathways .

  • Promoter activity studies: Construct reporter fusions (e.g., UbiB promoter-GFP) to directly visualize transcriptional regulation in response to changing oxygen levels.

  • Protein expression analysis: Use Western blotting with anti-UbiB antibodies or MS-based proteomics to quantify UbiB protein levels across oxygen gradients.

  • Metabolic flux analysis: Combine isotope labeling with metabolomics to track changes in ubiquinone biosynthetic pathway flux under different oxygen conditions.

  • Comparative studies: Analyze how UbiB function compares to UbiT, UbiU, and UbiV proteins that are involved in the O₂-independent pathway .

  • Mutant phenotyping: Compare the growth and metabolic characteristics of wild-type, UbiB-deficient, and UbiU/V-deficient strains under varying oxygen conditions.

This experimental design would take advantage of Shewanella's natural ability to adapt to environments with fluctuating oxygen levels, providing insights into how ubiquinone biosynthesis is regulated across the entire O₂ range .

What are the common challenges in working with recombinant Shewanella proteins and how can they be addressed?

Working with recombinant Shewanella proteins presents several challenges that researchers should anticipate:

  • Codon usage bias: Shewanella codon usage differs from E. coli, potentially causing translation inefficiencies. This can be addressed by using codon-optimized synthetic genes or E. coli strains supplying rare tRNAs (like Rosetta strains).

  • Membrane protein solubility: Many Shewanella proteins, including UbiB, have transmembrane segments . This requires careful detergent selection during extraction and purification, with mild non-ionic detergents (DDM, LDAO) often proving effective.

  • Protein stability: Recombinant proteins may show limited stability. Current protocols recommend storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 and addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

  • Post-translational modifications: If Shewanella-specific modifications are required for activity, heterologous expression may result in inactive protein. Consider testing multiple expression systems or supplementing with Shewanella cell extracts.

  • Functional assays: Developing specific and sensitive assays for UbiB activity can be challenging. Consider both direct assays (substrate to product conversion) and indirect assays (complementation of deficient strains).

To minimize protein degradation, it's recommended to avoid repeated freeze-thaw cycles and to store working aliquots at 4°C for no more than one week .

How can researchers distinguish between UbiB activity and other related proteins in ubiquinone biosynthesis?

Distinguishing UbiB activity from other related proteins in ubiquinone biosynthesis requires strategic experimental design:

  • Genetic approaches: Create clean knockout strains for UbiB and related genes (UbiT, UbiU, UbiV, etc.) to assess specific phenotypes. Complementation studies with individual genes can confirm specific functions .

  • Biochemical specificity: Design in vitro assays with purified recombinant proteins using specific substrates that differentiate between the activities of different Ubi proteins. For example, UbiB is involved in the first monooxygenase step, while other proteins catalyze different reactions in the pathway .

  • Structural biology: Determine the three-dimensional structures of UbiB and related proteins to identify unique structural features that correlate with specific functions.

  • Domain-swapping experiments: Create chimeric proteins by swapping domains between UbiB and related proteins to map functional regions.

  • Metabolite profiling: Analyze the accumulation of pathway intermediates in specific mutant strains using LC-MS/MS to pinpoint the reaction catalyzed by each protein.

  • Oxygen-dependence analysis: Compare the activities of O₂-dependent (including UbiB) and O₂-independent (UbiU-UbiV) pathways under varying oxygen conditions .

Recent research has shown that the O₂-independent UbiU-UbiV system represents a novel class of hydroxylases with 4Fe-4S clusters, distinct from UbiB's proposed kinase-like activity .

What analytical methods are most effective for quantifying ubiquinone and its precursors in Shewanella cultures?

The most effective analytical methods for quantifying ubiquinone and its precursors in Shewanella cultures include:

  • High-Performance Liquid Chromatography (HPLC):

    • Reversed-phase HPLC with UV detection at 275 nm

    • Isocratic or gradient elution using methanol/ethanol and hexane mixtures

    • Allows separation of ubiquinone homologs with different isoprenoid chain lengths

  • Liquid Chromatography-Mass Spectrometry (LC-MS/MS):

    • Provides superior sensitivity and specificity compared to HPLC-UV

    • Multiple Reaction Monitoring (MRM) enables quantification of specific transitions

    • Can distinguish ubiquinone from structurally similar compounds

  • Sample preparation protocols:

    • Extraction with organic solvents (hexane:ethanol mixtures)

    • Lipid extraction by Bligh-Dyer method followed by solid-phase extraction

    • Internal standards (isotopically labeled ubiquinone) for accurate quantification

  • Analysis of biosynthetic intermediates:

    • Targeted metabolomics approach for pathway intermediates

    • Derivatization strategies to improve detection of polar intermediates

    • Ion-pairing chromatography for improved separation of charged precursors

These methods can be used to:

  • Track changes in ubiquinone levels under different growth conditions

  • Monitor accumulation of precursors in UbiB-deficient strains

  • Assess the relative contributions of O₂-dependent and O₂-independent pathways

  • Evaluate the effects of genetic manipulations on ubiquinone biosynthesis

How might understanding UbiB function contribute to research on bacterial adaptation to oxygen-limited environments?

Understanding UbiB function could significantly advance our knowledge of bacterial adaptation to oxygen-limited environments in several ways:

  • Metabolic flexibility: UbiB's role in ubiquinone biosynthesis directly impacts respiratory capabilities. Elucidating how UbiB functions alongside the O₂-independent pathway components (UbiT, UbiU, UbiV) would reveal mechanisms enabling bacteria to maintain electron transport chain function across oxygen gradients .

  • Environmental adaptation: Shewanella species inhabit diverse environments with varying oxygen availability. UbiB regulation may represent a key adaptation allowing these bacteria to colonize niches ranging from oxic to anoxic conditions .

  • Pathogen survival strategies: Several human pathogens possess both O₂-dependent and O₂-independent ubiquinone biosynthesis pathways. Understanding UbiB's contribution could provide insights into how pathogens survive oxygen fluctuations during infection processes .

  • Evolutionary implications: Comparing UbiB across bacterial species that occupy different ecological niches could reveal evolutionary adaptations to specific oxygen regimes.

  • Redox balancing mechanisms: UbiB likely contributes to maintaining cellular redox balance under changing oxygen conditions, a fundamental aspect of bacterial stress response.

Recent research has demonstrated that many proteobacteria are equipped with both O₂-dependent and O₂-independent pathways, supporting their ability to synthesize ubiquinone over the entire O₂ range. This metabolic versatility has been linked to antibiotic resistance, virulence, and the capacity to thrive in complex ecosystems like the microbiota .

What research gaps remain in our understanding of UbiB function in Shewanella species?

Several significant research gaps remain in our understanding of UbiB function in Shewanella species:

Addressing these gaps would significantly advance our understanding of bacterial ubiquinone biosynthesis, with potential applications in biotechnology and medical research.

How might research on UbiB contribute to the development of novel antimicrobial strategies?

Research on UbiB could contribute significantly to the development of novel antimicrobial strategies through several avenues:

  • Target validation: As an essential enzyme in ubiquinone biosynthesis, UbiB represents a potential target for antibacterial compounds. Inhibiting UbiB would disrupt electron transport and energy metabolism in pathogens like Shewanella putrefaciens, which has been implicated in rare but potentially severe infections .

  • Pathway-specific inhibitors: Understanding the structural and functional differences between the O₂-dependent (UbiB) and O₂-independent (UbiU-UbiV) pathways could enable the development of inhibitors targeting specific ubiquinone biosynthesis routes .

  • Host-pathogen interaction insights: Many pathogens encounter varying oxygen tensions during infection. Targeting UbiB might be particularly effective against pathogens in specific anatomical or physiological niches with defined oxygen levels.

  • Combination therapy strategies: Inhibitors of UbiB could potentially synergize with existing antibiotics that target energy metabolism or membrane function.

  • Resistance mitigation: The presence of alternative ubiquinone biosynthesis pathways suggests that targeting both O₂-dependent and O₂-independent routes simultaneously might reduce the likelihood of resistance development .

  • Virulence modulation: In some pathogens, ubiquinone biosynthesis has been linked to virulence factor expression. UbiB inhibition might attenuate virulence without directly killing bacteria, potentially reducing selective pressure for resistance.

This research direction is particularly relevant considering the increasing reports of Shewanella infections, including rare cases of sepsis in immunocompromised patients, highlighting the need for expanded therapeutic options .

What are the most promising directions for future research on Shewanella UbiB proteins?

The most promising directions for future research on Shewanella UbiB proteins include:

  • Structural biology approaches: Determining the three-dimensional structure of UbiB would significantly advance understanding of its catalytic mechanism and facilitate structure-based drug design efforts.

  • Systems biology integration: Positioning UbiB within the broader context of cellular metabolism through multi-omics approaches would reveal its connections to other metabolic networks and stress response pathways.

  • Comparative biochemistry: Detailed functional comparisons of UbiB from different Shewanella species that inhabit various ecological niches could reveal adaptations to specific environmental conditions.

  • Synthetic biology applications: Engineering UbiB and related proteins could enable the development of bacterial strains with enhanced ubiquinone production capabilities for biotechnological applications.

  • In vivo dynamics: Investigating the temporal and spatial regulation of UbiB in response to changing environmental conditions, particularly oxygen fluctuations, would illuminate adaptation mechanisms.

  • Interspecies comparisons: Expanding studies to compare UbiB function across diverse bacterial phyla could provide evolutionary insights into the development of oxygen adaptation strategies.

  • Drug discovery platforms: Establishing high-throughput screening systems to identify UbiB inhibitors would open new avenues for antimicrobial development against Shewanella and other pathogens possessing UbiB.

These research directions would build upon current knowledge of UbiB in ubiquinone biosynthesis and potentially yield applications in medicine, biotechnology, and environmental science.

How might advances in protein expression and purification techniques impact research on recombinant UbiB proteins?

Advances in protein expression and purification techniques are poised to significantly impact research on recombinant UbiB proteins in several ways:

  • Membrane protein expression systems: Novel expression systems optimized for membrane proteins, such as cell-free systems supplemented with nanodiscs or liposomes, could improve the yield and native folding of UbiB proteins, which contain transmembrane segments .

  • Cryo-EM compatibility: Advances in membrane protein purification that maintain native lipid environments (e.g., styrene-maleic acid copolymer extraction) could facilitate structural studies of UbiB by cryo-electron microscopy.

  • Co-expression strategies: Improved co-expression systems for multi-protein complexes could enable production of functional UbiB with its interacting partners, potentially stabilizing the protein and preserving activity.

  • Post-translational modification control: Systems that allow control over post-translational modifications could help elucidate their role in UbiB regulation and function.

  • High-throughput purification platforms: Automated, parallel purification systems would enable systematic optimization of conditions for UbiB stability and activity.

  • On-column activity assays: Development of techniques that allow activity assessment during purification could help maintain enzymatic function throughout the process.

  • Native mass spectrometry: Advances in native MS techniques could provide insights into UbiB complex formation and cofactor binding without requiring crystallization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.