Recombinant Shewanella putrefaciens Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Shewanella putrefaciens Protease HtpX (htpX) is a metalloprotease expressed heterologously in Escherichia coli. This enzyme, encoded by the htpX gene (locus: Sputcn32_2334), belongs to the EC 3.4.24.- classification and is recognized for its role in protein quality control under stress conditions . It is annotated as a heat shock protein, suggesting involvement in cellular stress responses .

Primary Structure

  • Amino Acid Sequence: Comprises 287 residues (UniProt ID: A4Y7X2) .

  • Sequence Features: Includes a conserved protease domain and a His-tag for purification .

Recombinant Expression and Purification

PropertyDetails
Expression SystemE. coli
TagN-terminal His-tag
Molecular Weight~31.6 kDa (calculated from 287 residues)
Purity>90% (SDS-PAGE verified)
StorageTris/PBS buffer with 50% glycerol; stable at -20°C/-80°C

Proteolytic Activity

HtpX exhibits ATP-independent metalloprotease activity, facilitating the degradation of misfolded proteins under stress . Comparative proteomics studies highlight its upregulation in S. putrefaciens strains with higher spoilage potential, correlating with increased extracellular protease activity .

Role in Bacterial Spoilage

  • Fish Spoilage: Strains overexpressing HtpX (e.g., S. putrefaciens 00A) demonstrate enhanced proteolysis of myofibrillar proteins, accelerating tissue degradation .

  • Cold Adaptation: Despite reduced metabolic rates at 4°C, HtpX activity recovers during later growth phases, enabling spoilage even under refrigeration .

Key Studies on HtpX

  1. Proteomic Analysis of Spoilage Potential

    • Extracellular Protease Activity: S. putrefaciens 00A (HtpX-upregulated) showed 115.09% higher protease activity than strain 00B after 8 days at 4°C .

    • Protein Degradation: SDS-PAGE confirmed HtpX-mediated hydrolysis of fish muscle proteins, correlating with spoilage markers like TVB-N and TMA .

  2. Stress Response Mechanisms

    • Cold Stress: Quantitative proteomics revealed HtpX upregulation alongside peptidases and amino acid metabolism enzymes, enabling nutrient scavenging in low-temperature environments .

Research Use

  • Recombinant Protein Production: Sold as lyophilized powder (50 µg to bulk quantities) for biochemical assays .

  • Enzyme Characterization: Utilized to study metalloprotease mechanisms and bacterial stress responses .

Industrial Relevance

  • Food Preservation: Insights into HtpX’s role in spoilage inform strategies to inhibit protease activity in refrigerated seafood .

References (Integrated Citations)

This review synthesizes data from product specifications , peer-reviewed studies on spoilage mechanisms , and proteomic analyses . Key findings are corroborated by UniProt annotations and experimental validations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Sputcn32_2334; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Target Names
htpX
Target Protein Sequence
MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK AMGCEVITMPRDGTERWLVETVARQAQQAGIKMPEVAIYQSPEMNAFATGPSKDNSLVAV STGLLYGMSQDEVEAVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNVVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKHKMIAAL ERLRQGPESTAMPAQMSAFGINGKRSMAEMMMSHPPLEKRIAALQAR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protease HtpX and what is its fundamental role in bacterial systems?

Protease HtpX is a membrane-bound zinc metalloprotease that participates in the proteolytic quality control of membrane proteins. Based on studies in Escherichia coli, HtpX works in conjunction with FtsH (a membrane-bound and ATP-dependent protease) to maintain membrane protein homeostasis. HtpX functions as a zinc-dependent endoprotease member of the membrane-localized proteolytic system, demonstrating activity against both membrane and soluble proteins .

In bacterial systems like Shewanella, HtpX is classified as a heat shock protein that helps organisms respond to environmental stresses by facilitating the degradation of misfolded or damaged membrane proteins, thereby maintaining cellular integrity under stress conditions .

How does S. putrefaciens HtpX compare structurally to HtpX from other Shewanella species?

When comparing the HtpX proteins from different Shewanella species, there are notable similarities but also key differences:

FeatureS. putrefaciens HtpXS. halifaxensis HtpXS. sp. (strain W3-18-1) HtpX
UniProt IDA4Y7X2B0TJN4A1RIL6
Length287 amino acids287 amino acids287 amino acids (partial listed)
SynonymshtpX; Sputcn32_2334; Protease HtpX; Heat shock protein HtpXhtpX; Shal_2473; Protease HtpX; Heat shock protein HtpXProtease HtpX
Key regionsMembrane-spanning domains; zinc-binding motifsMembrane-spanning domains; zinc-binding motifsMembrane-spanning domains; zinc-binding motifs

Sequence alignment shows high conservation in the catalytic domains and transmembrane regions, with most sequence variations occurring in the loop regions. The conservation reflects the fundamental importance of this protease across Shewanella species, suggesting similar functional mechanisms .

What expression systems are most effective for producing functional recombinant S. putrefaciens HtpX?

E. coli has been demonstrated as an effective expression system for producing recombinant S. putrefaciens HtpX. The protein is typically expressed with an N-terminal His-tag to facilitate purification . Key considerations include:

  • Expression vector selection: Vectors with strong inducible promoters (T7, tac) are preferred for controlled expression.

  • Host strain optimization: E. coli strains like BL21(DE3) or Rosetta(DE3) are commonly used, particularly when membrane protein expression is required.

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often improve the yield of properly folded membrane proteins.

  • Membrane fraction handling: Special attention to membrane fraction isolation is necessary since HtpX is membrane-bound .

Research has shown that HtpX undergoes self-degradation upon cell disruption or membrane solubilization, complicating purification efforts. To address this challenge, purification under denaturing conditions followed by controlled refolding in the presence of zinc chelators has proven effective .

What are the critical steps for successful purification of active recombinant HtpX?

Successful purification of active recombinant HtpX requires careful attention to several critical factors:

  • Denaturing purification: Due to self-degradation issues, purification under denaturing conditions (typically using urea or guanidinium hydrochloride) has been successful .

  • Controlled refolding: Refolding should be performed in the presence of zinc chelators to prevent premature activation and self-degradation. Subsequent supplementation with Zn²⁺ can restore enzymatic activity when desired .

  • Buffer optimization: The protein should be maintained in Tris/PBS-based buffer with stabilizing agents such as 6% trehalose at pH 8.0 for optimal stability .

  • Storage considerations: For long-term storage, the addition of 50% glycerol and storage at -20°C/-80°C is recommended. Working aliquots can be maintained at 4°C for up to one week .

  • Reconstitution protocol: Prior to use, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What assays are recommended for verifying the proteolytic activity of purified HtpX?

Several assays have been validated for determining the proteolytic activity of HtpX:

  • Self-cleavage assay: Monitoring the self-degradation of purified HtpX in the presence of Zn²⁺ serves as a preliminary verification of proteolytic activity .

  • Casein degradation assay: HtpX has been shown to degrade casein in the presence of zinc, providing a convenient substrate for activity assessment .

  • Membrane protein substrate cleavage: Using solubilized membrane proteins like SecY as substrates can validate the native activity of HtpX .

  • Turbidity reduction assay: Similar to assays used for lysis-related proteins, this method can measure the decrease in optical density of bacterial suspensions, though this would need to be adapted specifically for HtpX activity .

  • Zinc-dependency verification: Comparing activity in the presence and absence of zinc confirms the zinc-dependent nature of the protease .

How can researchers investigate the substrate specificity of S. putrefaciens HtpX?

Investigating substrate specificity of S. putrefaciens HtpX requires a multi-faceted approach:

  • In vitro substrate screening: Testing the activity of purified HtpX against a panel of potential substrates including:

    • Soluble proteins (e.g., casein, BSA)

    • Membrane proteins (e.g., SecY, which has been verified as a substrate for E. coli HtpX)

    • Synthetic peptides with varying sequences

  • Co-expression studies: Overexpressing both HtpX and potential substrate proteins in vivo to observe degradation patterns, similar to the approach used with E. coli HtpX and SecY .

  • Proteomic approaches: Comparative proteomics of wild-type versus HtpX-deficient strains to identify accumulated proteins that may represent natural substrates.

  • Site-directed mutagenesis: Modifying the predicted catalytic residues of HtpX to create inactive variants, which can be used in substrate-trapping experiments.

  • Structural biology techniques: Employing X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of HtpX in complex with substrates or substrate analogs.

What experimental strategies are effective for studying the membrane localization and topology of HtpX?

Understanding the membrane localization and topology of HtpX is crucial for elucidating its function. Recommended approaches include:

  • Membrane fractionation: Separating cellular components to confirm localization of HtpX in membrane fractions.

  • Protease accessibility assays: Using proteases that cannot cross membranes to determine which domains are exposed to different cellular compartments.

  • Fluorescent protein fusions: Creating fusions with fluorescent proteins at different positions to visualize localization and orientation.

  • Cysteine scanning mutagenesis: Introducing cysteine residues at various positions and using membrane-impermeable sulfhydryl reagents to determine exposed regions.

  • Computational prediction validation: Experimental verification of computational predictions of transmembrane domains, which suggest that S. putrefaciens HtpX, like other HtpX proteins, has multiple membrane-spanning regions that anchor it in the membrane with specific catalytic domains positioned for substrate access .

How does zinc dependency affect HtpX activity, and what are the implications for experimental design?

The zinc dependency of HtpX has significant implications for experimental design:

  • Metal chelation effects: HtpX activity is inhibited in the presence of zinc chelators, which can be strategically used during purification to prevent self-degradation .

  • Zinc concentration optimization: Determination of optimal zinc concentrations for activity assays is essential, as both insufficient and excessive zinc levels can affect results.

  • Metalloprotease inhibitor profiles: Establishing the inhibitor profile using various metalloprotease inhibitors helps characterize the enzyme's active site.

  • Site-directed mutagenesis of zinc-binding residues: Mutating predicted zinc-binding residues can confirm their role in catalysis and substrate binding.

  • Zinc replacement studies: Experimenting with other divalent metals (e.g., Co²⁺, Mn²⁺) to understand metal specificity and potential alternative activities.

Research with E. coli HtpX has demonstrated that the proteolytic activity is strictly dependent on zinc supplementation, which activates its self-cleavage and substrate degradation capabilities . This property must be carefully controlled in experimental designs, particularly when evaluating potential inhibitors or when studying structure-function relationships.

What are common challenges in working with recombinant HtpX and their solutions?

Researchers commonly encounter several challenges when working with HtpX:

  • Self-degradation: HtpX undergoes self-degradation upon cell disruption or membrane solubilization.

    • Solution: Purify under denaturing conditions and refold in the presence of zinc chelators. Only add zinc when activity measurement is desired .

  • Low expression levels: As a membrane protein, expression levels can be suboptimal.

    • Solution: Optimize codon usage, use specialized expression strains, and consider fusion tags that enhance expression.

  • Inclusion body formation: Overexpression can lead to inclusion body formation.

    • Solution: Lower induction temperatures, reduce inducer concentration, or use solubility-enhancing fusion partners.

  • Refolding inefficiency: Proper refolding of membrane proteins is challenging.

    • Solution: Use gradual dialysis with decreasing denaturant concentrations and include appropriate lipids or detergents to mimic the membrane environment.

  • Activity loss during storage: Proteolytic activity may diminish during storage.

    • Solution: Store at -80°C with glycerol (50%) or trehalose (6%) as cryoprotectants, and avoid repeated freeze-thaw cycles .

How can researchers interpret contradictory results in HtpX activity assays?

When faced with contradictory results in HtpX activity assays, consider the following interpretive framework:

  • Zinc concentration effects: Verify that zinc concentrations are consistent across experiments, as variations can lead to significant differences in activity levels .

  • Buffer composition influence: Different buffer systems can affect HtpX activity. Standardize to Tris/PBS-based buffers at pH 8.0 for comparable results .

  • Substrate preparation variables: For membrane protein substrates, the solubilization method can impact accessibility to HtpX. Standardize preparation protocols for consistent results.

  • Temperature and pH optimization: Establish activity profiles across temperature and pH ranges. S. putrefaciens proteins often show activity across wide temperature and pH ranges, similar to the documented activity of lysis-related proteins from S. putrefaciens phage .

  • Protein quality assessment: Verify protein quality before each assay, as degradation during storage can lead to inconsistent results. Use SDS-PAGE to confirm integrity .

  • Detection method sensitivity: Different detection methods have varying sensitivities. When possible, confirm results using multiple detection approaches to ensure reliability.

What strategies can resolve experimental variability in membrane protein extraction for HtpX studies?

Membrane protein extraction for HtpX studies can introduce significant variability. Researchers should consider:

  • Standardized cell disruption: Use consistent methods (e.g., sonication, French press) with controlled parameters to ensure comparable membrane fractions.

  • Detergent selection: Different detergents can extract membrane proteins with varying efficiencies and may affect protein activity differently. Systematic testing of detergents (e.g., DDM, CHAPS, Triton X-100) can identify optimal conditions.

  • Lipid composition effects: The lipid environment affects membrane protein behavior. Consider adding specific phospholipids during extraction or purification to maintain native-like conditions.

  • Salt and pH conditions: Optimize and standardize salt concentrations and pH during extraction to control for ionic interactions that may affect protein stability and activity.

  • Quantitative recovery assessment: Implement quantitative measures of recovery efficiency at each step to identify sources of variability and loss.

By carefully controlling these variables, researchers can minimize experimental variability and obtain more consistent results when working with HtpX and other membrane proteins.

How does S. putrefaciens HtpX function compare to HtpX from model organisms like E. coli?

While E. coli HtpX has been characterized as a zinc-dependent endoprotease involved in the proteolytic quality control of membrane proteins , comparative studies of S. putrefaciens HtpX suggest both functional conservation and adaptation:

  • Conserved catalytic mechanism: Both proteins appear to function as zinc-dependent metalloproteases with similar catalytic domains and metal dependencies .

  • Environmental adaptation: S. putrefaciens HtpX may have evolved specific properties suitable for the organism's natural habitats, including marine environments and refrigerated food storage conditions.

  • Substrate range differences: While E. coli HtpX has demonstrated activity against SecY and casein , the natural substrate range of S. putrefaciens HtpX may differ to accommodate the specific membrane protein quality control needs of this organism.

  • Stress response roles: Both proteins are classified as heat shock proteins, suggesting conserved roles in stress response, but the specific stressors that induce expression may differ between organisms .

What potential applications exist for recombinant S. putrefaciens HtpX in biotechnology and food safety research?

S. putrefaciens is recognized as a specific spoilage organism in seafood , making its proteases potentially relevant for several applications:

  • Biopreservation strategies: Understanding HtpX's role in S. putrefaciens survival under refrigeration conditions could inform novel approaches to prevent seafood spoilage.

  • Antimicrobial development: Like the lysis-related proteins from Shewanella phages that have shown potential as antibacterial agents , HtpX inhibitors could be developed to target S. putrefaciens.

  • Diagnostic tools: Recombinant HtpX could be used to develop antibodies or other detection systems for monitoring S. putrefaciens contamination in food products.

  • Enzyme technology: The temperature resistance and broad pH activity range demonstrated in other Shewanella enzymes suggest potential applications in industrial processes requiring robust proteases.

  • Structural biology research: As a membrane metalloprotease, HtpX represents an interesting target for structural studies that could advance understanding of this important class of enzymes.

What key experimental questions remain unresolved regarding S. putrefaciens HtpX function?

Despite the available information on S. putrefaciens HtpX, several important questions remain:

  • Natural substrate identification: What are the natural substrates of S. putrefaciens HtpX in vivo, and how do they relate to the organism's physiology and stress responses?

  • Regulatory mechanisms: How is HtpX expression regulated in S. putrefaciens, and what environmental signals trigger its upregulation?

  • Structural characterization: What is the three-dimensional structure of S. putrefaciens HtpX, and how does it compare to other membrane metalloproteases?

  • Interaction partners: Does S. putrefaciens HtpX work in conjunction with other proteases like FtsH, as observed in E. coli , or does it function within a different proteolytic network?

  • Role in pathogenesis: Does HtpX contribute to the virulence or survival of S. putrefaciens in host environments, particularly in opportunistic infections?

  • Evolutionary adaptation: How has HtpX evolved across Shewanella species to accommodate different environmental niches, and what structural features reflect these adaptations?

Addressing these questions will require integrated approaches combining genetics, biochemistry, structural biology, and systems biology to fully elucidate the role of HtpX in S. putrefaciens biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.