Recombinant Shewanella putrefaciens UPF0114 protein Sputcn32_0673 (Sputcn32_0673)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Sputcn32_0673; UPF0114 protein Sputcn32_0673
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Target Names
Sputcn32_0673
Target Protein Sequence
MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHVLPIIFEMREVDLVLVTLSL IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH LLKIFMNVENISNDKIMWYLLIHITFVLSAFAMGYLDKITRK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant Sputcn32_0673?

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modificationsBasic structural studies, antibody production
YeastBetter protein folding, some post-translational modificationsModerate yield, more complex cultivationFunctional studies requiring proper folding
Mammalian cellsNative-like post-translational modificationsHigher cost, longer production timeInteraction studies, functional assays
Insect cellsGood for membrane proteins, intermediate complexitySpecialized equipment neededStudies requiring complex folding

For most basic research applications, E. coli expression with an N-terminal His-tag provides sufficient quality and quantity of the protein . When selecting an expression system, researchers should carefully consider the specific research questions being addressed and the downstream applications.

What are the recommended storage and reconstitution protocols for Sputcn32_0673?

For optimal stability and activity of recombinant Sputcn32_0673, the following storage and reconstitution protocols are recommended:

Storage recommendations:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard) for long-term storage

  • Make small aliquots to avoid repeated freeze-thaw cycles

The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . Researchers should validate protein activity after reconstitution using application-specific assays.

What experimental designs are recommended for studying Sputcn32_0673 function?

When investigating the function of Sputcn32_0673, a systematic experimental approach is essential. Following the principles of robust experimental design , researchers should:

  • Define variables clearly:

    • Independent variable: Typically the presence/absence or concentration of Sputcn32_0673

    • Dependent variable: Measurable outcomes (e.g., binding activity, cellular response)

    • Control variables: Factors that must be standardized (pH, temperature, buffer composition)

  • Formulate specific hypotheses:

    • Based on bioinformatic predictions of UPF0114 family functions

    • Drawing on known roles of similar proteins in Shewanella species

  • Design controlled treatments:

    • Include appropriate positive and negative controls

    • Use varying concentrations of the protein to establish dose-response relationships

    • Consider site-directed mutagenesis to identify critical functional residues

  • Select appropriate subject assignment:

    • Between-subjects design: Different experimental units receive different treatments

    • Within-subjects design: Same experimental units assessed under multiple conditions

  • Plan measurement methods:

    • Select assays with appropriate sensitivity and specificity

    • Validate measurement techniques with known standards

When presenting data from these experiments, researchers should follow established guidelines for creating data tables that clearly show the relationship between independent and dependent variables, with proper labeling of units and statistical measures.

What techniques are most effective for studying protein-protein interactions involving Sputcn32_0673?

To investigate protein-protein interactions involving Sputcn32_0673, researchers can employ multiple complementary techniques:

TechniqueResolution LevelAdvantagesLimitationsData Output
Co-immunoprecipitationProtein complexDetects interactions in near-native conditionsRequires specific antibodiesQualitative binding
Pull-down assaysProtein complexUtilizes the His-tag already presentMay detect non-physiological interactionsSemi-quantitative binding
Surface Plasmon ResonanceDirect bindingReal-time kinetics, no labels requiredRequires purified proteinsBinding constants (kd, ka, KD)
Yeast two-hybridBinary interactionsHigh-throughput screeningHigh false positive rateBinary interaction maps
Crosslinking-MSResidue-level contactsIdentifies direct contact sitesComplex data analysisInteraction interfaces

For initial studies, pull-down assays leveraging the His-tag on the recombinant Sputcn32_0673 provide a straightforward approach . This can be followed by more specialized techniques based on initial findings.

The two-way co-immunoprecipitation approach demonstrated in the DNM2 protein study provides a methodological template that can be adapted for Sputcn32_0673 research . This technique can confirm protein-protein interactions while maintaining physiologically relevant conditions.

How can researchers evaluate the membrane association properties of Sputcn32_0673?

The amino acid sequence of Sputcn32_0673 reveals hydrophobic regions potentially associated with membrane interactions . To evaluate these properties:

  • Bioinformatic prediction:

    • Analyze the sequence using transmembrane prediction algorithms

    • Identify hydrophobic domains and potential membrane-spanning regions

  • Experimental validation:

    • Membrane fractionation studies to determine localization

    • Liposome binding assays with purified protein

    • Fluorescent labeling and microscopy for cellular localization

  • Functional membrane studies:

    • Reconstitution in artificial membrane systems

    • Evaluation of ion or small molecule transport activity

    • Membrane integrity assays in the presence of varying protein concentrations

Particularly relevant is the approach used in advanced membrane protein studies where nanoscale cell membrane particles are extracted while maintaining protein conformation and activity . This approach could be adapted for Sputcn32_0673 to preserve its native membrane environment during functional studies.

What approaches are recommended for studying the role of Sputcn32_0673 in bacterial adaptation mechanisms?

To investigate the role of Sputcn32_0673 in Shewanella putrefaciens adaptation, researchers can build upon methodologies demonstrated in recent studies of bacterial adaptation:

  • Gene deletion and complementation:

    • Create knockout strains lacking Sputcn32_0673

    • Perform complementation with wild-type and mutant variants

    • Assess phenotypic changes under various environmental conditions

  • Experimental evolution:

    • Subject bacterial populations to selection pressures in controlled environments

    • Monitor changes in Sputcn32_0673 expression or sequence

    • Analyze adaptation mechanisms as demonstrated in recent Shewanella studies

  • Comparative genomics approach:

    • Analyze Sputcn32_0673 conservation across Shewanella species

    • Correlate sequence variations with ecological niches

    • Identify co-evolving genes that may function in the same pathway

Recent research on Shewanella putrefaciens has demonstrated how experimental selection for increased spreading through porous environments can reveal bacterial adaptation mechanisms . Similar approaches could be applied to understand the specific role of Sputcn32_0673 in adaptation processes.

How can protein structure prediction tools be applied to understand Sputcn32_0673 function?

With advances in AI-based protein structure prediction technologies, researchers can gain insights into Sputcn32_0673 function:

  • Structure prediction workflow:

    • Submit the full 162-amino acid sequence to prediction platforms

    • Compare outputs from multiple algorithms for consensus

    • Validate key structural features through targeted experimental approaches

  • Functional inference from structure:

    • Identify potential binding pockets or active sites

    • Compare with structures of proteins with known functions

    • Analyze conservation of structurally important residues

  • Structure-guided experimental design:

    • Target specific residues for mutagenesis based on structural predictions

    • Design truncated constructs based on domain boundaries

    • Create fusion proteins that preserve critical structural features

The future of full-length protein research is being transformed by AI-based technologies like AlphaFold2, which significantly improve prediction accuracy for proteins with unknown structures . These approaches are particularly valuable for proteins like Sputcn32_0673 where experimental structural data may be limited.

What are common challenges in expressing and purifying full-length Sputcn32_0673 and how can they be addressed?

Researchers working with recombinant Sputcn32_0673 may encounter several technical challenges:

ChallengeCauseSolution
Low expression yieldProtein toxicity to host, rare codonsOptimize codon usage, use specialized host strains (e.g., Rosetta-GAMI)
Truncated productsImproper translation initiation, proteolysisUse dual-tagged constructs, increase imidazole concentration during elution
Inclusion body formationImproper protein foldingLower induction temperature, co-express with chaperones
Poor solubilityHydrophobic regionsAdd solubilizing tags (MBP, GST), optimize buffer conditions
Loss of activityImproper folding, tag interferenceConsider tag removal, validate activity with multiple assays

These challenges are common with membrane-associated proteins like Sputcn32_0673. The hydrophobic regions evident in the amino acid sequence (particularly positions 11-31) may contribute to expression difficulties . Adjusting expression conditions such as temperature, induction time, and host strain selection can significantly improve yields.

How can researchers validate the purity and integrity of recombinant Sputcn32_0673?

To ensure experimental reproducibility, researchers should validate protein quality using multiple approaches:

  • Purity assessment:

    • SDS-PAGE analysis (target >90% purity)

    • Mass spectrometry for precise molecular weight confirmation

    • Size-exclusion chromatography to detect aggregation

  • Integrity verification:

    • Western blot with tag-specific and protein-specific antibodies

    • N-terminal sequencing to confirm proper translation initiation

    • Mass spectrometry to detect post-translational modifications or degradation

  • Functional validation:

    • Activity assays specific to predicted function

    • Binding studies with predicted interaction partners

    • Structural analysis through circular dichroism or thermal shift assays

These validation steps should be performed after each purification batch to ensure consistency between experiments. Documentation of these quality control measures should be included in research publications to facilitate reproducibility.

What are the potential applications of Sputcn32_0673 in comparative bacterial studies?

Recombinant Sputcn32_0673 can serve as a valuable tool in comparative studies of bacterial adaptation and evolution:

  • Comparative genomics applications:

    • Identify homologs in related bacterial species

    • Analyze sequence conservation across diverse environments

    • Correlate genetic variations with ecological niches

  • Evolutionary studies:

    • Reconstruct phylogenetic relationships based on UPF0114 protein families

    • Investigate selective pressures on Sputcn32_0673 across bacterial species

    • Analyze co-evolution with interacting proteins

  • Functional conservation testing:

    • Cross-species complementation experiments

    • Heterologous expression studies

    • Comparative protein-protein interaction mapping

The experimental approaches used in recent studies of Shewanella putrefaciens adaptation provide a methodological framework that can be adapted to investigate the specific role of Sputcn32_0673 in bacterial evolution and adaptation.

What emerging technologies might enhance future research on Sputcn32_0673?

Several emerging technologies show promise for advancing research on proteins like Sputcn32_0673:

  • Advanced computational approaches:

    • AI-based structure prediction to reveal functional domains

    • Molecular dynamics simulations to study membrane interactions

    • Deep learning for function prediction from sequence data

  • High-resolution imaging techniques:

    • Cryo-electron microscopy for structural studies

    • Super-resolution microscopy for cellular localization

    • Correlative light and electron microscopy for contextual analysis

  • Single-molecule techniques:

    • FRET studies to analyze protein dynamics

    • Optical tweezers to measure mechanical properties

    • Single-molecule tracking in live cells

  • Multi-omics integration:

    • Combining proteomics, transcriptomics, and metabolomics data

    • Network analysis to position Sputcn32_0673 in cellular pathways

    • Systems biology approaches to understand contextual function

Particularly promising is the application of deep learning techniques for protein design, which may enable the creation of Sputcn32_0673 variants with enhanced properties for specific experimental applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.