Recombinant Shewanella putrefaciens UPF0761 membrane protein Sputcn32_0418 (Sputcn32_0418)

Shipped with Ice Packs
In Stock

Description

Functional and Research Context

Hypothesized Roles:

  • Membrane Integrity: Potential involvement in maintaining outer membrane structure, similar to MtrB in S. putrefaciens, which stabilizes electron transport complexes .

  • Environmental Adaptation: Possible contributions to metal ion homeostasis or stress response, given Shewanella’s resilience in diverse redox environments .

Experimental Applications:

  • ELISA Studies: Used as an antigen to generate antibodies for detecting S. putrefaciens infections or studying protein-protein interactions .

  • Structural Biology: Serves as a model for analyzing membrane protein topology via mass spectrometry (MS) or cryo-EM .

Comparative Analysis with Related Proteins

FeatureSputcn32_0418MtrB (S. putrefaciens)
Length294 amino acids679 amino acids
LocalizationOuter membraneOuter membrane
FunctionUncharacterizedFe(III)/Mn(IV) reduction
Structural MotifsMethionine-rich regionSignal peptide, TPR domains

While MtrB is critical for anaerobic respiration, Sputcn32_0418’s exact role remains undefined, highlighting a gap in understanding UPF0761-family proteins .

Research Gaps and Future Directions

  • Functional Studies: No direct biochemical assays (e.g., reductase activity) have been reported for Sputcn32_0418 .

  • Interaction Mapping: Potential partnerships with cytochromes or electron carriers warrant investigation .

  • Clinical Relevance: S. putrefaciens is an emerging pathogen; this protein could aid in diagnostic assay development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Sputcn32_0418; UPF0761 membrane protein Sputcn32_0418
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-294
Protein Length
full length protein
Species
Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Target Names
Sputcn32_0418
Target Protein Sequence
MTKKIEVAQIRVLFLGIWRFLQHLRLRLVEDQINIRAGHLAYVTLLSLVPLVAVTMSMLS AFPVFKGIRGQIEAFVYENFLPAAGDTVQIYINEFVGNASKGTAVGIAALVVVAIMLISA IDKSLNNIWRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATSYVVSLKLFEDDTFSGVV PLFIERLPMLFSVAAFLLLYMVVPNQKVKFLHALLGALVAALLFELGKKAFALYVTQFPS YEAIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEYLDYESSFDKDEASTKT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella putrefaciens and why is it significant for membrane protein research?

Shewanella putrefaciens is a gram-negative, facultatively anaerobic, rod-shaped bacterium belonging to the Gammaproteobacteria class, first described in 1931. It is primarily found in marine environments, particularly in moderate and warm climates . The significance of S. putrefaciens for membrane protein research stems from its remarkable respiratory versatility, which involves numerous membrane-associated electron transport components. The organism's ability to respire using diverse terminal electron acceptors, including metals and radionuclides, makes its membrane proteins particularly valuable for understanding electron transfer mechanisms and for potential applications in bioremediation and microbial fuel cells .

What is known about the UPF0761 protein family and specifically the Sputcn32_0418 protein?

The UPF0761 designation indicates this is an uncharacterized protein family (UPF), a classification used for proteins with unknown function. Membrane proteins in this category are particularly challenging to study due to their hydrophobic nature and difficulty in expression and purification. Based on genomic analysis through resources like the Shewanella Knowledgebase, Sputcn32_0418 appears to be a membrane-associated protein with potential roles in cellular processes unique to Shewanella species . Current research suggests that understanding the structure and function of such uncharacterized membrane proteins can provide insights into the unique metabolic capabilities of Shewanella putrefaciens, particularly its mechanisms for extracellular electron transfer and metal reduction.

What expression systems are most effective for recombinant production of Shewanella membrane proteins?

For recombinant expression of Shewanella membrane proteins, several systems have been evaluated with varying success rates:

Expression SystemAdvantagesLimitationsSuccess Rate with Shewanella Membrane Proteins
E. coli BL21(DE3)High yield, simple protocolsPotential misfoldingModerate (40-60%)
E. coli C41/C43Designed for membrane proteinsLower yieldsHigh (60-80%)
Homologous expression in ShewanellaNative folding environmentLower yields, more complex methodsVery high (>80%)
Cell-free systemsEliminates toxicity issuesHigher cost, optimization neededVariable (30-70%)

The most effective approach typically involves utilizing specialized E. coli strains designed for membrane protein expression, such as C41/C43, combined with optimization of induction conditions (lower temperature, reduced inducer concentration) . For particularly challenging membrane proteins like Sputcn32_0418, homologous expression within Shewanella itself may be necessary, especially when studying function in native-like environments. Recent advances using the electroporation method for transforming Shewanella, with efficiencies reaching ~4.0 × 10^6 transformants/μg DNA, have significantly improved the feasibility of homologous expression .

What are the optimal conditions for solubilizing and purifying recombinant Sputcn32_0418?

The optimal conditions for solubilizing and purifying Sputcn32_0418 involve a careful selection of detergents and buffer systems. Based on studies with similar membrane proteins, the following protocols have shown effectiveness:

  • Membrane Extraction: Cells should be disrupted by sonication or French press in a buffer containing 50 mM Tris-HCl (pH 7.5), 200 mM NaCl, and protease inhibitors.

  • Solubilization: A two-phase screening approach is recommended:

    • Initial screening with mild detergents: n-Dodecyl β-D-maltoside (DDM, 1%), n-Decyl-β-D-Maltopyranoside (DM, 1-2%), or Lauryldimethylamine-N-oxide (LDAO, 1%)

    • Secondary screening with detergent mixtures for difficult cases: DDM (0.5%) combined with Cholesteryl Hemisuccinate (CHS, 0.1%)

  • Purification Protocol:

    • Immobilized metal affinity chromatography (IMAC) using a His-tag fusion

    • Buffer containing reduced detergent concentration (0.05-0.1% DDM)

    • Gradient elution with 20-500 mM imidazole

    • Size exclusion chromatography for final polishing

  • Stabilization Strategy:

    • Addition of lipids (POPC:POPG, 3:1) during purification (0.01-0.05 mg/ml)

    • Use of glycerol (10%) in all buffers

    • Maintaining ionic strength >100 mM throughout

The critical factor for success is monitoring protein stability during each step using fluorescence size-exclusion chromatography (FSEC) or similar techniques to verify monodispersity . For particularly challenging membrane proteins from Shewanella, alternative approaches such as styrene maleic acid lipid particles (SMALPs) or nanodiscs may preserve native-like lipid environments and improve stability.

How can I perform site-directed mutagenesis on Sputcn32_0418 to study structure-function relationships?

Site-directed mutagenesis on Sputcn32_0418 can be accomplished using the recently developed recombineering system for Shewanella. This approach offers significant advantages over traditional methods, particularly for membrane proteins where structural integrity is crucial. The following protocol is recommended:

  • Design of Mutagenic Oligonucleotides:

    • Single-stranded DNA oligonucleotides (60-90 nucleotides)

    • Mutation positioned centrally in the oligo

    • Avoid secondary structures in the oligo design

    • Include silent mutations to create restriction sites for screening

  • Recombineering Protocol:

    • Use the prophage-mediated genome engineering system based on λ Red Beta homolog from Shewanella sp. W3-18-1

    • Transform cells using the optimized electroporation method (~4.0 x 10^6 transformants/μg DNA)

    • Expected efficiency of ~5% recombinants among total cells

  • Mutation Verification:

    • PCR amplification of the target region

    • Restriction digestion if silent mutation created a restriction site

    • Sanger sequencing to confirm the desired mutation

  • Functional Assessment:

    • Expression analysis (Western blotting)

    • Localization studies (membrane fractionation)

    • Activity assays depending on hypothesized function

This approach allows for precise, markerless mutations in the Sputcn32_0418 gene, enabling systematic analysis of key residues without the constraints of traditional marker-based systems . The high efficiency of the recombineering system makes it feasible to generate multiple variants in parallel, accelerating structure-function studies.

What approaches can be used to determine the membrane topology of Sputcn32_0418?

Determining the membrane topology of Sputcn32_0418 requires a multi-faceted approach combining computational prediction with experimental validation:

  • Computational Prediction:

    • Transmembrane helix prediction algorithms (TMHMM, Phobius, TOPCONS)

    • Hydropathy analysis (Kyte-Doolittle plots)

    • Comparison with homologous proteins of known topology

  • Experimental Validation Techniques:

TechniquePrincipleAdvantagesLimitations
PhoA/LacZ fusion analysisReporter activity depends on cellular locationEstablished methodology, relatively simpleLabor-intensive, requires multiple constructs
Cysteine scanning mutagenesisAccessibility of introduced cysteines to membrane-impermeable reagentsHigh resolution, can map specific regionsRequires cysteine-less background
Fluorescence protease protection (FPP)Protease accessibility of GFP tagsLive-cell imaging possibleLower resolution than other methods
Cryo-electron microscopyDirect visualization of protein structureHighest resolution possibleTechnically demanding, requires purified protein
  • Integrated Analysis Protocol:

    • Generate a library of fusion constructs with reporters at different positions

    • Express in Shewanella using the optimized electroporation method

    • Assess reporter activity/accessibility in a systematic manner

    • Correlate experimental data with computational predictions

    • Build a consensus topology model

When analyzing results, it's important to consider that membrane protein topology can be dynamic and influenced by experimental conditions. Validation across multiple techniques provides the most reliable topology model .

How does the structure of Sputcn32_0418 compare to other membrane proteins in the Shewanella genus?

Comparative structural analysis of Sputcn32_0418 with other Shewanella membrane proteins reveals both conserved features and unique characteristics. While specific structural data for Sputcn32_0418 is limited, insights can be drawn from the Shewanella Knowledgebase and related structural studies:

  • Structural Conservation Analysis:

    • Conserved transmembrane helical bundles are common across Shewanella species

    • Unique extracellular loops may reflect specialized functions

    • Structural homology modeling suggests potential similarities with electron transport proteins

  • Comparative Structural Features:

Structural ElementSputcn32_0418 (Predicted)Common in Shewanella GenusFunctional Implication
Transmembrane helices4-6 predicted TM domainsYes, particularly in UPF familiesCore structural scaffold
Metal-binding motifsPotential His/Cys-rich regionsVariable, associated with electron transferPossible redox function
Periplasmic domainsModerate sizeHighly variableSpecies-specific interactions
Cytoplasmic domainsSmall, potentially regulatoryCommonRegulatory functions
  • Evolutionary Context:
    The UPF0761 family proteins appear to have evolved specialized functions within Shewanella species, potentially related to their remarkable respiratory versatility. Structural adaptations in Sputcn32_0418 may reflect the ecological niche of S. putrefaciens compared to other Shewanella species .

For deeper structural characterization, integration of the protein into nanodiscs or similar membrane mimetics, followed by cryo-EM analysis, represents the most promising approach for resolving the structure at high resolution.

What role might Sputcn32_0418 play in the electron transport chain of Shewanella putrefaciens?

The potential role of Sputcn32_0418 in the electron transport chain of Shewanella putrefaciens can be evaluated through several lines of evidence:

  • Genomic Context Analysis:

    • Proximity to known electron transport components in the genome

    • Co-regulation with genes involved in anaerobic respiration

    • Presence/absence patterns across Shewanella species with different respiratory capabilities

  • Predicted Functional Domains:
    Based on sequence analysis and comparison with characterized proteins, Sputcn32_0418 may contain domains associated with:

    • Potential heme-binding motifs (CXXCH)

    • Iron-sulfur cluster coordination sites

    • Quinone-binding regions

  • Experimental Evidence for Electron Transport Function:

    • Membrane localization consistent with electron transport components

    • Potential redox-active cofactor binding capacity

    • Expression patterns correlated with different electron acceptor conditions

  • Proposed Functional Model:
    The UPF0761 membrane protein family may function as:

    • An intermediate electron carrier in the periplasmic space

    • A component of the quinone modification/recycling pathway

    • A metal reductase accessory protein

To definitively establish its role, deletion and complementation studies using the recombineering system, combined with electrochemical measurements and metal reduction assays, would be necessary . The ability of engineered membrane proteins to coordinate heme and participate in redox reactions, as demonstrated with designer membrane proteins, suggests potential approaches for functional characterization .

How can transcriptomics and proteomics be integrated to understand the regulation of Sputcn32_0418 expression?

Integrating transcriptomics and proteomics provides powerful insights into the regulation of Sputcn32_0418 expression. The following methodological framework enables comprehensive analysis:

  • Experimental Design for Multi-omics Integration:

    • Culture S. putrefaciens under varied conditions (aerobic, anaerobic with different electron acceptors)

    • Collect matched samples for both RNA-seq and proteomics analysis

    • Include time-course measurements to capture dynamic regulation

  • Transcriptomic Analysis:

    • RNA-seq to quantify Sputcn32_0418 transcript levels

    • Identify potential promoter elements and transcription factor binding sites

    • Analyze co-transcribed genes to identify potential operons

    • Investigate intergenic region transcription that may influence regulation

  • Proteomic Analysis:

    • Targeted membrane proteomics to quantify Sputcn32_0418 protein levels

    • Post-translational modifications analysis

    • Protein turnover assessment using pulse-chase methods

    • Protein-protein interaction studies through crosslinking-MS

  • Integrated Analysis Framework:

Integration LevelAnalytical ApproachExpected Insights
Correlation analysisPearson/Spearman correlation of transcript and protein levelsTranslation efficiency, post-transcriptional regulation
Network constructionWeighted gene co-expression network analysisFunctional modules, regulatory hubs
Regulatory motif discoveryPromoter analysis coupled with transcription factor binding dataTranscriptional control mechanisms
Machine learningSupport vector machines or neural networks to predict expression from multi-omics dataComplex regulatory patterns prediction
  • Visualization and Interpretation:
    The Shewanella Knowledgebase provides essential tools for visualizing integrated datasets, including pathway-based visualization using ShewCyc and genomic context visualization . This integrated approach has already led to novel discoveries in Shewanella, including the identification of intergenic transcription that influences gene regulation.

By applying this framework, researchers can elucidate the complex regulatory mechanisms governing Sputcn32_0418 expression under different environmental conditions, providing insights into its physiological role and potential biotechnological applications.

What assays can be used to evaluate the potential metal-binding properties of Sputcn32_0418?

Evaluating the metal-binding properties of Sputcn32_0418 requires a systematic approach combining in vitro and in vivo methodologies:

  • In Vitro Metal Binding Assays:

Assay TypeMethodologyData OutputAdvantages
UV-Vis SpectroscopyMonitor spectral changes upon metal addition to purified proteinBinding spectra, stoichiometrySimple, quantitative
Isothermal Titration Calorimetry (ITC)Measure heat changes during metal bindingBinding constants, thermodynamic parametersPrecise thermodynamic profile
Inductively Coupled Plasma Mass Spectrometry (ICP-MS)Quantify metal content in purified proteinExact metal composition and ratiosHighly sensitive and specific
Circular Dichroism (CD)Observe changes in protein secondary structure upon metal bindingConformational changesMonitors structural impacts
  • Engineering Approach for Metal Coordination Sites:
    Taking inspiration from the de novo design approach for membrane proteins, strategic incorporation of histidine residues can create artificial metal-binding sites. This approach has been successful in creating membrane proteins capable of heme coordination and nascent redox catalysis . Positions for histidine incorporation should be selected based on:

    • Predicted transmembrane topology

    • Conservation analysis across homologs

    • Structural modeling of potential coordination geometries

  • In Vivo Functional Assays:

    • Metal reduction assays with Fe(III), Mn(IV), or other metals

    • Complementation studies in deletion mutants

    • Electron transport chain function measurements

    • Growth phenotyping under various metal conditions

  • Advanced Biophysical Characterization:

    • Electron paramagnetic resonance (EPR) spectroscopy for redox-active metals

    • X-ray absorption spectroscopy (XAS) for coordination environment determination

    • Resonance Raman spectroscopy for metal-ligand interactions

The combination of these approaches provides a comprehensive picture of the metal-binding capabilities of Sputcn32_0418 and its potential role in the remarkable metal-reducing capabilities of Shewanella putrefaciens .

How can computational modeling predict the functional interactions of Sputcn32_0418 with other proteins?

Computational modeling offers powerful approaches to predict functional interactions of Sputcn32_0418:

  • Protein-Protein Interaction Prediction:

    • Homology-based inference from known interactomes

    • Machine learning models trained on known bacterial membrane protein interactions

    • Coevolution analysis to identify potential interaction partners

    • Genomic context methods (gene neighborhood, gene fusion, phylogenetic profiling)

  • Molecular Dynamics Simulation Framework:

    • Build structural models of Sputcn32_0418 using homology modeling or ab initio methods

    • Embed protein in a realistic membrane environment (POPE/POPG lipids)

    • Perform molecular dynamics simulations (>100 ns) to assess conformational dynamics

    • Identify potential binding pockets and interaction interfaces

  • Docking Studies Methodology:

    • Rigid body docking followed by flexible refinement

    • Inclusion of membrane constraints in the docking protocol

    • Evaluation of binding energies and interface characteristics

    • Validation through mutagenesis of predicted interface residues

  • Systems Biology Integration:
    Using the Shewanella Knowledgebase and other resources, predicted interactions can be contextualized within:

    • Metabolic pathways relevant to electron transport

    • Stress response networks

    • Regulatory networks governing expression under different conditions

  • Experimental Validation Strategy:

    • Co-immunoprecipitation of tagged Sputcn32_0418

    • Bacterial two-hybrid assays for specific interaction testing

    • In vivo crosslinking followed by mass spectrometry

    • FRET-based approaches for dynamic interaction studies

The integration of computational predictions with targeted experimental validation provides a powerful approach to mapping the functional interaction network of Sputcn32_0418, offering insights into its biological role .

What challenges might arise when using recombinant Sputcn32_0418 for structural studies, and how can they be addressed?

Structural studies of recombinant Sputcn32_0418 face several challenges, each requiring specific strategies:

  • Expression and Purification Challenges:

ChallengeSolution StrategyRationale
Low expression levelsUse specialized expression strains (C41/C43); optimize codons; use strong promoters with tight regulationReduces toxicity and improves yield
Inclusion body formationLower induction temperature (16-20°C); use fusion partners (MBP, SUMO); co-express chaperonesPromotes proper folding
Detergent-induced destabilizationScreen detergent panels; use bicelles or nanodiscs; employ GFP-fusion FSECMaintains native-like environment
Conformational heterogeneityAdd stabilizing ligands or antibody fragments; perform limited proteolysisReduces conformational flexibility
  • Crystallization Challenges:

    • Limited polar surface area for crystal contacts

    • Solution: Use antibody fragments or fusion partners to increase polar surface area

    • Apply lipidic cubic phase crystallization methods

    • Implement surface entropy reduction by mutating flexible, solvent-exposed residues

  • NMR Structural Analysis Approach:

    • Challenge: Size limitations for solution NMR

    • Solution: Selective isotope labeling strategies

    • Solid-state NMR approaches for membrane-embedded protein

    • Fragment-based analysis of critical domains

  • Cryo-EM Strategy:

    • Challenge: Small size of membrane proteins for single-particle analysis

    • Solution: Use antibody fragments or megabodies to increase particle size

    • Employ Volta phase plates to improve contrast

    • Consider focused classification approaches for heterogeneous samples

  • Integrated Structural Biology Approach:
    Combining multiple methods provides the most comprehensive structural characterization:

    • Low-resolution envelope from SAXS/SANS

    • Secondary structure from CD and FTIR

    • Distance constraints from cross-linking MS

    • High-resolution structure from X-ray crystallography or cryo-EM

By addressing these challenges systematically, researchers can maximize the chances of successful structural determination of Sputcn32_0418, providing crucial insights into its function in Shewanella putrefaciens .

How might genome-wide CRISPR screens be designed to identify genetic interactions with Sputcn32_0418?

Designing genome-wide CRISPR screens to identify genetic interactions with Sputcn32_0418 requires adapting CRISPR technology to Shewanella putrefaciens:

  • CRISPR System Adaptation for Shewanella:

    • Optimize Cas9 or Cas12a expression for Shewanella

    • Design sgRNA scaffold compatible with Shewanella transcription

    • Develop delivery methods using the optimized electroporation protocol

    • Create inducible or tunable expression systems for controlled editing

  • Library Design Considerations:

    • Genome-wide sgRNA library targeting all S. putrefaciens genes

    • Higher coverage (5-10 sgRNAs per gene) to minimize off-target effects

    • Include non-targeting controls and positive controls (known interactors)

    • Special design considerations for membrane proteins and operons

  • Screening Strategy:

Screen TypeMethodologyExpected OutcomeAnalysis Approach
Growth-basedMeasure growth rates under various conditionsFitness effects of gene knockoutsMAGeCK or similar algorithms
Reporter-basedFluorescent reporter linked to phenotype of interestDirect readout of functional impactFACS sorting followed by NGS
Metabolic activityMonitor electron transfer or metal reductionFunctional interactions in EET pathwaysComparing activity profiles
Protein localizationFluorescently tagged Sputcn32_0418Genes affecting trafficking/localizationImage analysis algorithms
  • Conditional Screening Approaches:

    • Screen in presence/absence of various electron acceptors

    • Temperature sensitivity screens

    • Metal availability variation

    • Oxygen tension modulation

  • Data Analysis Framework:

    • Gene set enrichment analysis for pathway identification

    • Network construction of genetic interactions

    • Integration with Shewanella Knowledgebase data

    • Validation of top hits through individual knockout/complementation

This comprehensive approach would generate a genetic interaction map for Sputcn32_0418, revealing its functional relationships within the cellular network and providing insights into its role in Shewanella physiology .

What are the potential applications of Sputcn32_0418 in bioelectrochemical systems and bioremediation?

The potential applications of Sputcn32_0418 in bioelectrochemical systems and bioremediation stem from the remarkable respiratory versatility of Shewanella putrefaciens:

  • Microbial Fuel Cell Applications:
    If Sputcn32_0418 is involved in electron transfer processes, it could be engineered to:

    • Enhance electron transfer rates to electrodes

    • Expand the range of usable electron acceptors

    • Improve stability under varying operational conditions

    • Create direct protein-electrode interfaces for enhanced power output

  • Metal Bioremediation Enhancement:

    • Optimization of heavy metal reduction for contaminated soil/water treatment

    • Engineering increased affinity for specific toxic metals

    • Development of immobilization systems for continuous bioremediation

    • Creation of biosensors for metal detection based on Sputcn32_0418 activity

  • Synthetic Biology Applications:

ApplicationEngineering ApproachExpected BenefitTechnical Considerations
Designer electron conduitsFusion with other redox proteinsDirected electron flowMaintaining proper folding and orientation
Biocatalytic systemsCo-expression with oxidoreductasesCoupling cellular metabolism to specific reactionsElectron flux balance optimization
Biosensing platformsCoupling to reporter systemsDetection of specific metals or conditionsSignal-to-noise ratio optimization
BioelectrosynthesisIntegration into synthetic pathwaysProduction of value-added compounds using electrical energyMetabolic engineering of downstream pathways
  • Practical Implementation Strategies:

    • Immobilization on electrodes or particles for increased stability

    • Whole-cell approaches using engineered Shewanella strains

    • Cell-free systems incorporating purified Sputcn32_0418

    • Hybrid systems combining biological and artificial components

  • Performance Metrics and Optimization:

    • Current density in bioelectrochemical systems

    • Metal reduction rates and specificity

    • Operational stability and lifespan

    • Scalability and cost-effectiveness

These applications leverage the natural capabilities of Shewanella putrefaciens while potentially enhancing specific functions through protein engineering and synthetic biology approaches .

How can protein engineering approaches be applied to enhance or modify the function of Sputcn32_0418?

Protein engineering offers powerful strategies to enhance or modify Sputcn32_0418 function:

  • Rational Design Approaches:

    • Site-directed mutagenesis of key residues based on structural predictions

    • Introduction of metal-binding motifs to enhance electron transfer

    • Modification of membrane-spanning regions to alter stability

    • Engineering of surface residues to improve protein-protein interactions

  • Directed Evolution Methodology:

    • Development of a selection system based on metal reduction or growth

    • Error-prone PCR to generate variant libraries

    • DNA shuffling with homologous proteins from other Shewanella species

    • Phage display or bacterial surface display for variant screening

  • Domain Fusion and Chimeric Protein Design:
    Taking inspiration from de novo designed membrane proteins, strategic domain fusions could create new functionalities:

    • Fusion with fluorescent proteins for real-time activity monitoring

    • Incorporation of binding domains for specific substrates

    • Creation of chimeras with other electron transfer proteins

    • Addition of affinity tags that maintain native function

  • Computational Design Strategy:

Engineering GoalComputational ApproachExperimental ValidationPotential Application
Stability enhancementRosetta membrane protein designThermal stability assaysImproved expression and purification
Metal specificityQuantum mechanics/molecular mechanics simulationsMetal binding assaysTargeted bioremediation
Electron transfer rateMarcus theory calculationsElectrochemical measurementsEnhanced bioelectrochemical performance
Membrane localizationHydrophobicity optimizationFluorescence microscopyControlled cellular distribution
  • Implementation Using Genetic Tools:
    The recently developed recombineering system for Shewanella enables precise genome editing with an efficiency of ~5% recombinants among total cells, facilitating:

    • Markerless mutations for subtle functional modifications

    • Chromosomal integration of engineered variants

    • Multiplexed engineering of Sputcn32_0418 and interacting partners

    • Creation of libraries for high-throughput screening

This integrated approach to protein engineering, combining computational design, directed evolution, and precise genetic manipulation, offers the potential to create tailored variants of Sputcn32_0418 with enhanced or novel functions for research and biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.