Recombinant Shewanella sediminis 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

UbiA belongs to the UbiA superfamily of prenyltransferases, which utilize a conserved aspartate-rich motif (DXXDXXXD) to coordinate Mg²⁺ and the pyrophosphate group of the prenyl donor . Structural homology modeling predicts ten transmembrane α-helices and a central cavity accommodating aromatic substrates like 4-hydroxybenzoate .

Substrate Specificity

While S. sediminis ubiA primarily processes 4-hydroxybenzoate, related UbiA homologs (e.g., UbiA-297 from Maribacter sp.) exhibit divergent substrate preferences, such as farnesylating quinoline derivatives (e.g., 8-hydroxyquinoline-2-carboxylic acid) . This highlights evolutionary adaptations in prenyltransferases across bacterial taxa.

Applications in Research

  1. Ubiquinone Biosynthesis Studies: Recombinant ubiA enables mechanistic investigations into coenzyme Q production, a pathway critical for cellular respiration .

  2. Enzyme Engineering: The His-tagged protein facilitates mutagenesis studies to probe residues like Arg145, which may influence substrate binding .

  3. Biotechnological Production: Serves as a template for optimizing prenylated metabolite synthesis, including antimicrobial or anticancer compounds .

Stability and Handling Protocols

  • Lyophilization: Stored as a lyophilized powder to maintain activity .

  • Reconstitution: Centrifuge vials before reconstitution to minimize aggregation .

  • Avoid Freeze-Thaw Cycles: Aliquot into working volumes to prevent degradation .

Comparative Analysis with Homologs

FeatureS. sediminis ubiA UbiA-297 (Marine Flavobacteria)
Substrate4-hydroxybenzoateQuinoline derivatives (e.g., 8-HQA)
Prenyl DonorOctaprenyl diphosphateFarnesyl diphosphate
Conserved MotifDXXDXXXDModified Mg²⁺-binding domain
Structural HighlightTyr-56 in substrate-binding siteArg145 implicated in catalytic activity

Research Limitations and Future Directions

While recombinant ubiA production in E. coli is well-established , purification of active membrane-bound forms remains challenging due to solubility issues . Future work may focus on:

  • Detergent Optimization: Improving extraction efficiency without denaturation.

  • In Vivo Assays: Leveraging S. sediminis genetic tools (e.g., knockout mutants ) to study ubiA’s role in anaerobic respiration.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
ubiA; Ssed_0468; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Shewanella sediminis (strain HAW-EB3)
Target Names
ubiA
Target Protein Sequence
MNLRDKLDVYLRLARMDRPIGTLLLLWPCLMALLLAAGGMPDLKVLTIFIFGVVVMRACG CIINDYADRDLDAHVDRTKSRPLASGEVTGREALILFAVMGLFAFGLVLMLNPLVVKLSV VGIILTIIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQTGEVPAEAWWLFAANWCWTVAY DTMYAMVDREDDLKVGIKSTAILFGKYDRQIIGLFQLAALACFITAGWAADRGLVYGLGI ITFVGFSMYQQKLIHERERAPCFKAFLNNNWAGLSLFIALGVDYLI
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB. This generates the initial membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) and what is its role in Shewanella sediminis metabolism?

4-hydroxybenzoate octaprenyltransferase (ubiA) is a key enzyme in ubiquinone biosynthesis in Shewanella sediminis. This enzyme catalyzes the transfer of an octaprenyl group from octaprenyl diphosphate to 4-hydroxybenzoate, representing a critical step in the ubiquinone pathway. In S. sediminis, this enzyme belongs to the UbiA superfamily of intramembrane aromatic prenyltransferases .

Metabolically, ubiA's role is particularly significant in S. sediminis because:

  • It enables production of ubiquinones, which serve as electron carriers in respiration

  • It contributes to the organism's adaptation to deep-sea, low-oxygen environments

  • It supports the remarkable respiratory versatility of Shewanella species, allowing them to utilize multiple electron acceptors

The enzyme is encoded by the ubiA gene (locus tag Ssed_0468) in S. sediminis strain HAW-EB3, which was isolated from Halifax Harbour sediment and is known for its psychrophilic (cold-loving) and piezotolerant (pressure-tolerant) characteristics .

What are the structural and biochemical properties of S. sediminis ubiA protein?

The S. sediminis ubiA protein exhibits several key structural and biochemical properties:

Structural Characteristics:

  • Membrane-bound intramembrane enzyme with multiple transmembrane domains

  • Contains hydrophobic regions to anchor it within the membrane

  • Features multiple conserved aspartate residues that form the active site

  • Likely adopts a structure similar to other UbiA family members with a central cavity for substrate binding

Biochemical Properties:

  • Requires divalent cations (particularly Mg²⁺) for catalytic activity

  • Operates optimally under specific pH conditions (likely around pH 7.8, similar to E. coli homolog)

  • Utilizes octaprenyl diphosphate as the prenyl donor substrate

  • Demonstrates specificity for 4-hydroxybenzoate as the prenyl acceptor substrate

  • Likely exhibits increased activity at lower temperatures, consistent with the psychrophilic nature of S. sediminis

The enzyme's activity can be assessed by measuring the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate, though direct experimental data specific to the S. sediminis enzyme is limited in the current literature.

What expression systems are most effective for recombinant production of S. sediminis ubiA?

Given the membrane-bound nature of ubiA and data from similar enzymes, the following expression systems have proven effective for recombinant production:

Expression SystemAdvantagesConsiderationsYield Potential
E. coli BL21(DE3)Well-established protocols, rapid growthMay require membrane fraction isolation, potentially lower activityModerate (3000-fold enrichment reported for E. coli ubiA)
E. coli C41(DE3)Optimized for membrane proteins, reduced toxicityRequires careful induction optimizationHigh for membrane proteins
Yeast (P. pastoris)Post-translational modifications, proper membrane insertionLonger expression time, more complex protocolsHigh for functional enzyme
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesHigher cost, specialized equipment neededVariable

For S. sediminis ubiA specifically:

  • Expression should include the complete coding sequence (Ssed_0468)

  • Optimal results likely require supplementation with prenyl substrate precursors

  • Activity is best preserved by avoiding detergent extraction, as the enzyme typically remains active in the membrane fraction

  • Codon optimization for the expression host may improve yields

For accurate functional studies, expression should be followed by isolation of the membrane fraction rather than attempting complete solubilization, as complete extraction with detergents can significantly reduce activity, as demonstrated with the E. coli homolog .

What methods can be used to assay the enzymatic activity of recombinant S. sediminis ubiA?

Several methodological approaches can be employed to assay ubiA activity:

Radioactive Substrate Assay:

  • Utilize ¹⁴C-labeled 4-hydroxybenzoate or ³H-labeled prenyl diphosphate

  • Incubate with enzyme preparation in the presence of Mg²⁺

  • Extract products with organic solvent and quantify by scintillation counting

  • Provides high sensitivity but requires radioactive material handling facilities

HPLC-Based Methods:

  • React enzyme with substrates under optimized conditions

  • Extract products and analyze by reverse-phase HPLC

  • Detect products by UV absorbance (typically at 246-254 nm)

  • Can be coupled with mass spectrometry for product confirmation

Coupled Enzyme Assays:

  • Monitor release of pyrophosphate using pyrophosphatase and subsequent phosphate detection

  • Allows continuous monitoring but may be subject to interference

Recommended Assay Conditions:

  • Buffer: Typically Tris-HCl (pH 7.5-8.0) or HEPES (pH 7.5)

  • Required cofactors: 5-10 mM MgCl₂

  • Prenyl substrate: All-trans octaprenyl diphosphate (concentrations in µM range)

  • 4-hydroxybenzoate: 50-200 µM

  • Temperature: 15-25°C (considering S. sediminis is psychrophilic)

  • Detergents: Low concentrations (0.01%) of CHAPS may stimulate activity, while Triton X-100, Tween 80, and sodium deoxycholate likely inhibit activity

The enzyme activity can be calculated as nmol product formed per minute per mg protein under standard conditions.

How does the environmental adaptation of S. sediminis influence ubiA function?

S. sediminis was isolated from marine sediment and exhibits psychrophilic (cold-loving) and piezotolerant (pressure-tolerant) characteristics, which likely influence ubiA function in several ways:

Temperature Adaptation:

  • The ubiA enzyme likely exhibits higher catalytic efficiency at lower temperatures (4-15°C) compared to mesophilic homologs

  • May contain structural features that increase flexibility at low temperatures, allowing for substrate binding and product release

  • Could potentially have a broader temperature range for activity than homologs from non-psychrophilic organisms

Pressure Effects:

  • As a deep-sea bacterium, S. sediminis enzymes including ubiA may maintain function under increased hydrostatic pressure

  • Membrane-associated enzymes like ubiA may have adapted to maintain proper folding and function despite pressure effects on membrane fluidity

Substrate Specificity:

  • May have evolved specificity for prenyl substrates that maintain appropriate fluidity in membranes under cold conditions

  • Could show different kinetic parameters compared to homologs from mesophilic organisms

Respiratory Adaptation:

  • S. sediminis exhibits versatile respiratory capabilities including reductive dechlorination of tetrachloroethene (PCE)

  • ubiA contributes to ubiquinone biosynthesis, which supports the diverse electron transport chains needed for this metabolic flexibility

  • The enzyme may be regulated differently in response to oxygen limitation, which is common in marine sediments

These adaptations make S. sediminis ubiA particularly interesting for comparative studies with homologs from mesophilic or thermophilic organisms.

Advanced Research Questions

S. sediminis ubiA offers several promising applications in genome engineering and synthetic biology:

Ubiquinone Production Enhancement:

  • Strategic overexpression of S. sediminis ubiA could increase ubiquinone production in heterologous hosts

  • The psychrophilic nature of the enzyme may allow for ubiquinone production at lower temperatures, reducing energy costs in industrial applications

  • Could be incorporated into metabolic engineering strategies for production of ubiquinone and derivatives as antioxidants or pharmaceutical ingredients

Cold-Adapted Bioproduction:

  • Integration into pathways designed to function at lower temperatures

  • Potential for creating cold-active biocatalysts for industrial processes

  • Development of low-temperature fermentation processes with reduced cooling costs

Targeted Genome Modification:

  • The ubiA gene is a potential target for CRISPR/Cas-based genome editing in Shewanella species

  • Modification could alter electron transport capabilities, potentially enhancing bioremediation applications

  • As demonstrated in patent literature, CRISPR/Cas systems can be used to modify bacterial populations including Shewanella

Environmental Application Potential:

  • S. sediminis has shown capabilities for reductive dechlorination of tetrachloroethene (PCE)

  • Engineered strains with modified ubiA expression could potentially enhance this bioremediation capability

  • The psychrophilic nature of S. sediminis makes it suitable for environmental applications in colder environments

Challenges in Application:

  • Membrane-bound nature complicates heterologous expression

  • May require specific membrane composition for optimal function

  • Integration with other components of the electron transport chain needs careful consideration

These applications highlight the potential of S. sediminis ubiA beyond its native context, particularly in biotechnology applications that benefit from cold-active enzymes.

How does the genomic context of ubiA in S. sediminis influence its expression and regulation?

The genomic context of ubiA in S. sediminis provides important insights into its regulation and expression patterns:

Genomic Organization:

  • The ubiA gene in S. sediminis is found at locus Ssed_0468

  • It appears to be part of the ubiquinone biosynthetic gene cluster, though with potential differences from E. coli arrangement

  • Neighboring genes likely include other ubiquinone biosynthesis enzymes (ubiX, ubiD, etc.)

Regulatory Elements:

  • Likely controlled by promoters responsive to oxygen levels, similar to other respiratory genes in Shewanella

  • May contain binding sites for global regulators involved in respiratory flexibility

  • The gene expression is potentially coordinated with other components of the electron transport chain

Expression Patterns:

  • Expression may be upregulated under oxygen-limited conditions to support alternative respiration pathways

  • Could show temperature-dependent expression consistent with the psychrophilic nature of S. sediminis

  • May be differentially expressed in response to pressure changes, reflecting the piezotolerant nature of the organism

Comparative Genomic Analysis:

  • S. sediminis has one of the largest genomes among Shewanella species with higher coding density than neighboring strains

  • Contains numerous genes acquired through horizontal gene transfer, though ubiA appears to be part of the core genome rather than a horizontally acquired element

  • The gene content reflects adaptation to deep-sea sediment environments, including genes for anaerobic respiration that would function alongside the ubiquinone pathway

Understanding this genomic context is essential for designing expression strategies and for interpreting the role of ubiA in the broader metabolic network of S. sediminis.

What mutagenesis approaches can be applied to study structure-function relationships in S. sediminis ubiA?

Several mutagenesis approaches can be effectively applied to investigate structure-function relationships in S. sediminis ubiA:

Site-Directed Mutagenesis:

  • Target conserved aspartate residues in the NDXXDXXXD motifs to confirm their role in Mg²⁺ coordination

  • Modify residues lining the proposed substrate binding pocket to alter substrate specificity

  • Introduce mutations at the membrane interface to investigate membrane association

  • Create chimeric enzymes with domains from other species' ubiA to identify regions responsible for psychrophilic adaptation

Methodology:

  • Design primers containing desired mutations

  • Perform PCR with high-fidelity polymerase

  • Remove template DNA with DpnI digestion

  • Transform into E. coli

  • Verify mutations by sequencing

  • Express and characterize mutant proteins

Random Mutagenesis Approaches:

  • Error-prone PCR to generate libraries of random mutations

  • DNA shuffling with ubiA genes from different Shewanella species

  • Screen for variants with altered temperature profiles, substrate specificity, or catalytic efficiency

In-frame Deletion Construction:
Similar to the methodology used for creating gene deletions in S. sediminis :

  • Amplify approximately 750 bp upstream and downstream fragments of the target region

  • Join fragments via complementary tags added to inner primers

  • Ligate into appropriate vectors (e.g., pDS3.0 via SmaI restriction site)

  • Transform into E. coli DH5α-λpir or similar strain

  • Verify by sequencing and transform into S. sediminis through bi-parental mating

  • Screen for crossover events using PCR

  • Resolve integrated vectors by growth without selection and plating on sucrose-containing medium

  • Verify mutations by PCR and sequencing

Analysis of Mutant Phenotypes:

  • Assess enzyme activity using standardized assays

  • Determine kinetic parameters (Km, kcat) for various substrates

  • Evaluate temperature and pressure dependence of activity

  • Analyze membrane association and topology using reporter fusions

  • Measure ubiquinone production in vivo

These approaches can provide insights into the structural features that contribute to the unique properties of S. sediminis ubiA, particularly its adaptation to psychrophilic conditions.

How can advanced structural biology techniques be applied to characterize S. sediminis ubiA?

Characterizing the structure of membrane proteins like ubiA presents significant challenges but can yield valuable insights through these advanced approaches:

X-ray Crystallography:

  • Requires detergent solubilization or lipidic cubic phase crystallization

  • May benefit from fusion partners (e.g., T4 lysozyme) to increase solubility

  • Crystal screening should include conditions that maintain psychrophilic protein stability

  • Resolution of 2.5-3.0 Å would likely reveal key structural features

Cryo-Electron Microscopy (Cryo-EM):

  • Increasingly powerful for membrane protein structure determination

  • Can visualize protein in near-native lipid environment using nanodiscs or amphipols

  • May require particle averaging due to relatively small size of ubiA (~32 kDa)

  • Can potentially capture different conformational states during catalysis

NMR Spectroscopy:

  • Solution NMR challenging due to size and membrane association

  • Solid-state NMR can provide structural insights in membrane environment

  • Strategic isotope labeling (¹⁵N, ¹³C) required for detailed analysis

  • Particularly valuable for studying dynamics and substrate interactions

Molecular Dynamics Simulations:

  • Can model protein behavior in membrane environment

  • Useful for studying conformational changes during catalysis

  • Can incorporate temperature and pressure variables to understand psychrophilic adaptation

  • Requires accurate initial structure (homology model based on related UbiA structures)

Small Angle X-ray Scattering (SAXS):

  • Provides low-resolution envelope of protein structure in solution

  • Can complement other structural techniques

  • Useful for studying conformational changes upon substrate binding

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Identifies solvent-accessible regions and conformational dynamics

  • Can track structural changes upon substrate binding

  • Particularly valuable for membrane proteins resistant to crystallization

Implementation Strategy:

  • Generate homology model based on existing UbiA family structures

  • Validate model through mutagenesis of predicted key residues

  • Attempt crystallization with and without substrates/substrate analogs

  • Apply complementary techniques (Cryo-EM, HDX-MS) for dynamic information

  • Use molecular dynamics to investigate temperature and pressure adaptations

These approaches can provide critical insights into how S. sediminis ubiA structure relates to its function in deep-sea environments.

What methods are most effective for studying the integration of S. sediminis ubiA into metabolic and respiratory networks?

Investigating the integration of ubiA into broader metabolic and respiratory networks requires multilevel approaches:

Systems Biology Approaches:

  • RNA-Seq to identify co-expressed genes under varying conditions (oxygen levels, temperature, pressure)

  • Proteomics to map protein-protein interactions within membrane complexes

  • Metabolomics to trace ubiquinone production and utilization

  • Flux analysis to quantify contribution to electron transport

Genetic Manipulation Methods:

  • Construction of ubiA deletion mutants in S. sediminis using homologous recombination approaches

  • Complementation studies with native and mutant versions

  • Creation of reporter fusions to monitor expression under different conditions

  • CRISPR/Cas9-based genome editing for precise modifications

Protocol for Gene Deletion in S. sediminis:

  • PCR-amplify ~750 bp fragments upstream and downstream of ubiA

  • Join fragments using overlap extension PCR

  • Clone into appropriate vector (e.g., pDS3.0 via SmaI site)

  • Transform into E. coli, then transfer to S. sediminis via conjugation

  • Select for single crossover integrants

  • Counter-select on sucrose-containing medium for double crossover events

  • Verify deletion by PCR and sequencing

Respiratory Phenotype Analysis:

  • Growth assays under varying electron acceptor conditions

  • Measurement of respiration rates using oxygen electrodes or alternative acceptors

  • Analysis of membrane potential using fluorescent probes

  • Determination of ubiquinone/ubiquinol ratios in membrane fractions

Experimental Design Strategy:

ConditionVariablesMeasurementsExpected Outcomes
Aerobic growthTemperature, pressureGrowth rate, ubiA expression, ubiquinone levelsBaseline respiratory function
Anaerobic growthTerminal electron acceptors (fumarate, nitrate, etc.)Growth rate, ubiA expression, ubiquinone levelsRespiratory flexibility assessment
Oxygen-limitedVarying oxygen concentrationsRespiratory rates, gene expressionRegulation under environmentally relevant conditions
Cold adaptationTemperature shiftsMembrane composition, ubiquinone contentTemperature-specific adaptations

Integration with Shewanella Metal Reduction Pathways:

  • Investigate relationship between ubiquinone production and extracellular electron transfer capabilities

  • Examine effects of ubiA mutation on metal reduction capabilities

  • Study expression coordination between ubiA and genes encoding c-type cytochromes and other electron transport components

These approaches can provide a comprehensive understanding of how ubiA functions within the complex respiratory networks that enable S. sediminis to thrive in deep-sea environments.

How can comparative genomics be used to understand the evolution of ubiA in Shewanella species?

Comparative genomics offers powerful approaches to understand ubiA evolution in Shewanella:

Phylogenetic Analysis Framework:

  • Collect ubiA sequences from all sequenced Shewanella species

  • Include sequences from related genera and outgroups

  • Construct multiple sequence alignments using MUSCLE, MAFFT, or similar algorithms

  • Build phylogenetic trees using maximum likelihood or Bayesian methods

  • Map habitat information (depth, temperature, etc.) onto phylogeny

Sequence Conservation Analysis:

  • Identify conserved motifs across Shewanella species

  • Detect residues under positive or purifying selection

  • Compare conservation patterns between deep-sea and shallow-water species

  • Analyze potential co-evolution with other respiratory enzymes

Genome Context Examination:

  • Compare genomic neighborhoods of ubiA across Shewanella species

  • Identify potential operon structures and regulatory elements

  • Detect horizontal gene transfer events affecting ubiquinone biosynthesis genes

  • Analyze synteny of ubiquinone biosynthesis genes across species

Methodology Implementation:

  • Extract ubiA sequences and genomic context from complete Shewanella genomes

  • Perform multiple sequence alignment with MUSCLE or similar tools

  • Calculate sequence conservation using ConSurf or similar methods

  • Construct phylogenetic trees using RAxML, MrBayes or similar software

  • Test for selection using PAML, HyPhy or similar programs

  • Visualize genome contexts using tools like Artemis or MAUVE

Evolutionary Adaptations Analysis:
S. sediminis has evolved specific adaptations for its deep-sea habitat, with its ubiA gene potentially showing:

  • Cold-adaptation signatures (increased proportion of glycine residues, fewer proline residues)

  • Pressure-adaptation features (altered hydrophobic core packing)

  • Sequence modifications that affect membrane interaction

Comparative Characteristics Table:

SpeciesEnvironmentubiA LengthKey Differentiating FeaturesGenomic Context
S. sediminisMarine sediment, psychrophilic286 aaPotential cold adaptationsPart of standard ubiquinone biosynthesis cluster
S. oneidensisFreshwater, mesophilicVariableMetal reduction capabilitySimilar organization to E. coli
S. woodyiDeep sea, bioluminescentVariablePotential pressure adaptationsMay have unique regulatory elements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.