Recombinant Shewanella sediminis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant PlsY is expressed in Escherichia coli and purified via affinity chromatography using its N-terminal His tag. Critical parameters include:

  • Expression System: E. coli with codon optimization for bacterial hosts .

  • Purification Yield: >90% purity confirmed by SDS-PAGE .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C .

  • Reconstitution: Requires dilution in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term stability .

Biochemical Properties

PlsY exhibits substrate specificity for acyl-phosphate donors, distinguishing it from other acyltransferases like PlsC (1-acyl-sn-glycerol-3-phosphate acyltransferase) . Key findings:

  • Kinetic Parameters:

    • Apparent KmK_m for acyl-phosphate donors: ~120 µM (similar to homologs) .

    • Optimal activity at pH 7.5–8.5 and 20–25°C .

  • Thermostability: Rapid inactivation above 37°C due to structural denaturation .

Functional and Evolutionary Insights

PlsY is part of the type II fatty acid synthesis (FAS-II) system in Shewanella, which adapts to environmental stressors like low temperature and high pressure . Comparative genomic studies reveal:

  • Gene Cluster Conservation: The plsY locus is conserved across Shewanella species, often linked to fatty acid desaturases and regulators .

  • Adaptive Role: Upregulated under cold conditions to modulate membrane fluidity via branched-chain fatty acid incorporation .

Applications and Research Utility

  • Biochemical Studies: Used to investigate phospholipid biosynthesis mechanisms in extremophiles .

  • Industrial Potential: Enzyme engineering for biofuel production via tailored fatty acid synthesis .

Comparative Analysis with Related Enzymes

FeaturePlsYPlsC
Reaction CatalyzedAcylates glycerol-3-phosphateAcylates lysophosphatidic acid
Substrate PreferenceAcyl-phosphate donorsAcyl-ACP or acyl-CoA donors
Membrane AssociationIntegral membrane proteinPeripheral membrane protein
Role in EPA SynthesisIndirect (provides precursors)Direct (incorporates polyunsaturated acyl groups)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs when placing the order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Ssed_1077; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Shewanella sediminis (strain HAW-EB3)
Target Names
plsY
Target Protein Sequence
MTITTLTLGMILAAYLAGSISSAVLVCRLRGLPDPRTAGSGNPGATNVLRIGGASSAAMV LFFDMLKGALPAYIAFRLGIDQVALGAIAIAACLGHIFPIFFKFKGGKGVATAFGAMAPI GHELALALMVTWIVMVLISRYSSLAAITTAMLAPIYTWFLDERFTIPVAMLSTLIVIRHR DNIHRLLKGEESKVSRKKKG
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its function in Shewanella species?

Glycerol-3-phosphate acyltransferase (plsY) is a critical enzyme in phospholipid biosynthesis in Shewanella species. It catalyzes the first committed step in membrane phospholipid synthesis by transferring an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate, forming lysophosphatidic acid (LPA). In Shewanella species, plsY is also known by several synonyms including Acyl-PO4 G3P acyltransferase, G3P acyltransferase (GPAT), and Lysophosphatidic acid synthase . The enzyme plays a crucial role in bacterial membrane formation and adaptation to various environmental conditions, which is particularly important for Shewanella species that often inhabit diverse ecological niches, including marine sediments and aquatic environments. The functional plsY protein in Shewanella typically consists of 203 amino acids and contains multiple transmembrane domains that anchor it to the cell membrane where it performs its catalytic function .

How is recombinant Shewanella plsY typically expressed in laboratory settings?

Recombinant Shewanella plsY is typically expressed in E. coli expression systems using specialized vectors containing histidine tags for purification purposes. The standard protocol involves:

  • Cloning the plsY gene into an expression vector (such as p15TV-L or pET-21) with an appropriate tag (commonly His-tag)

  • Transforming the construct into a suitable E. coli strain such as BL21(DE3)

  • Growing cultures at 37°C until reaching an appropriate optical density (typically OD600 of 0.6-0.8)

  • Inducing protein expression with IPTG (isopropyl β-ᴅ-1-thiogalactopyranoside) at concentrations of 0.3-0.5 mM

  • Lowering the temperature to 15-18°C for overnight expression to enhance proper folding

  • Cell harvesting and protein purification using affinity chromatography

For optimal expression, some protocols recommend co-transformation with plasmids that enhance proper folding or post-translational modifications. The expression system may need optimization based on the specific Shewanella species from which the plsY gene originates, as codon usage and protein folding requirements can vary.

What are the recommended storage conditions for recombinant Shewanella plsY protein?

The optimal storage conditions for recombinant Shewanella plsY protein are:

Storage ParameterRecommended ConditionNotes
Temperature-20°C to -80°CLong-term storage requires -80°C
Protein FormLyophilized or in solution with glycerolLyophilized for maximum stability
Buffer CompositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein stability
Working Stock4°CStable for up to one week
Freeze-ThawAvoid repeated cyclesAliquot before freezing
Glycerol Concentration5-50% (final)Default recommendation is 50%

It is important to note that repeated freezing and thawing is not recommended as it can significantly decrease protein activity. For working samples, store aliquots at 4°C for up to one week to maintain enzymatic activity . When preparing for long-term storage, adding glycerol to a final concentration of 50% and storing in small aliquots helps prevent activity loss during freeze-thaw cycles.

How should lyophilized recombinant Shewanella plsY be reconstituted for experimental use?

For proper reconstitution of lyophilized recombinant Shewanella plsY:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material collects at the bottom of the tube

  • Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL

  • Allow the protein to fully dissolve at room temperature with gentle agitation

  • For long-term storage, add glycerol to a final concentration of 5-50% (commonly 50%)

  • Aliquot the reconstituted protein into smaller volumes to avoid repeated freeze-thaw cycles

  • Flash-freeze the aliquots in liquid nitrogen before transferring to -20°C or -80°C for storage

The reconstituted protein should be handled under sterile conditions to prevent contamination. For sensitive enzymatic assays, it is advisable to perform a pilot activity test after reconstitution to confirm that the enzyme has maintained its catalytic properties.

What experimental approaches are most effective for characterizing the enzymatic activity of recombinant Shewanella plsY?

Several complementary experimental approaches are recommended for comprehensive characterization of plsY enzymatic activity:

ApproachMethodologyParameters MeasuredAdvantages
Spectrophotometric AssaysCoupling plsY reaction with indicator reactions that produce colorimetric/fluorometric changesReaction kinetics (Km, Vmax, kcat)Real-time monitoring; quantitative data
Radiometric AssaysUsing 14C or 3H-labeled acyl-phosphate substratesAbsolute enzyme activity; substrate specificityHigh sensitivity; direct measurement
Mass SpectrometryLC-MS/MS analysis of reaction productsProduct identification; reaction intermediatesStructural confirmation of products
Circular DichroismUV spectroscopy of purified enzymeSecondary structure integrityConfirms proper protein folding
Thermal Shift AssaysDifferential scanning fluorimetryProtein stability; substrate bindingRapid screening of conditions
Isothermal Titration CalorimetryMeasuring heat changes during substrate bindingBinding affinity; thermodynamic parametersLabel-free; provides thermodynamic data

For optimal characterization, these approaches should be performed under various conditions to determine:

  • pH optimum (typically testing a range of pH 6.0-9.0)

  • Temperature dependence (15-45°C range)

  • Metal ion requirements (testing various divalent cations)

  • Substrate preference using different acyl-phosphate donors

  • Inhibition patterns with known acyltransferase inhibitors

The integration of these methods provides a comprehensive profile of enzyme activity and can reveal important structure-function relationships specific to Shewanella plsY.

How does the His-tag affect the structural and functional properties of recombinant Shewanella plsY?

The addition of a His-tag to recombinant Shewanella plsY represents an important experimental consideration that can influence both structural and functional properties:

Structural Impacts:

  • The His-tag (typically 6-10 histidine residues) adds approximately 1 kDa to the protein molecular weight

  • The tag may interfere with the native folding of the protein, particularly if placed at the N-terminus near transmembrane domains

  • Crystal structure determination may be complicated by the flexible nature of the tag

  • The His-tag may influence protein oligomerization or interaction with membrane mimetics

Functional Impacts:

  • Altered enzyme kinetics - studies show that His-tags can reduce enzyme activity by 10-30% in some membrane proteins

  • Modified substrate binding - the positively charged tag may influence electrostatic interactions with substrates

  • Potential for artificial metal ion coordination - the histidine residues have high affinity for divalent metal ions

Experimental Approaches to Address His-tag Effects:

  • Compare enzyme activities before and after tag removal using a protease cleavage site (e.g., TEV protease)

  • Express the protein with the tag at both N- and C-termini separately to determine optimal placement

  • Use circular dichroism and thermal stability assays to assess structural integrity with and without the tag

  • Perform detailed kinetic analyses to quantify any alterations in substrate affinity or catalytic efficiency

The best practice is to include appropriate controls in all experiments, potentially including tag-cleaved versions of the protein for critical assays, to ensure that observed enzymatic properties truly reflect the native plsY function rather than tag-induced artifacts.

What are the optimal conditions for expressing soluble and functional Shewanella plsY in heterologous systems?

Achieving optimal expression of soluble and functional Shewanella plsY in heterologous systems requires careful consideration of multiple factors:

Expression System Optimization:

  • Host strain selection:

    • BL21(DE3) with additional plasmids for rare codons is recommended

    • Consider specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

  • Vector and promoter choices:

    • pET series vectors with T7 promoter show good results for controlled expression

    • Constructs with p15TV-L plasmid have demonstrated success for similar proteins

  • Growth and induction protocol:

    • Grow cultures at 37°C until O.D.600 reaches 0.6-0.8

    • Cool to 15-18°C before induction with 0.3-0.5 mM IPTG

    • Extended expression (18+ hours) at lower temperatures improves folding

  • Media supplementation:

    • Add 50 μM cysteine to improve disulfide bond formation

    • Include 50 μM ammonium ferric citrate if iron-sulfur clusters are involved

    • Use enriched media like Terrific Broth for higher cell density

  • Co-expression strategies:

    • Co-transform with chaperone plasmids (e.g., pG-KJE8, pG-Tf2) to assist folding

    • For functional studies, consider co-expression with partner proteins that may stabilize plsY

  • Detergent selection for extraction:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM) or Triton X-100 (0.1%) preserve activity

    • Test a panel of detergents at different concentrations to optimize solubilization

Careful optimization of these conditions can significantly improve the yield of properly folded, active plsY enzyme from Shewanella species, enabling detailed biochemical and structural studies.

How can site-directed mutagenesis be effectively applied to investigate structure-function relationships in Shewanella plsY?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in Shewanella plsY. Based on methodologies described for related enzyme systems, the following comprehensive strategy is recommended:

Methodological Framework:

  • Target residue selection based on:

    • Sequence alignment with homologous enzymes from different bacterial species

    • Structural modeling to identify putative active site residues

    • Conserved motifs specific to the acyltransferase family

    • Residues predicted to interact with glycerol-3-phosphate or acyl-phosphate substrates

  • Mutagenesis approaches:

    • Site-directed PCR mutagenesis protocol as described by Edelheit et al.

    • Gibson assembly for introducing multiple mutations simultaneously

    • Whole-gene synthesis for extensive mutagenesis (as used for CfrA-Y80W-F125W in related research)

  • Types of mutations to consider:

    • Conservative substitutions to probe subtle functional effects (e.g., Y→F, D→E)

    • Non-conservative substitutions to dramatically alter chemical properties (e.g., Y→W, C→Y)

    • Alanine scanning to identify essential residues

    • Introduction of residues from homologous enzymes with different specificities

  • Validation and analysis:

    • Confirm mutations by Sanger sequencing

    • Verify protein expression by Western blotting

    • Assess structural integrity through circular dichroism

    • Measure enzyme kinetics with various substrates to determine changes in specificity

Strategic Mutation Targets:

Based on comparable studies in related enzymes, the following residue categories are particularly informative:

  • Catalytic residues: Those directly involved in bond formation/breaking

  • Substrate binding pocket residues: Those determining substrate chain length preference

  • Conformational residues: Those maintaining proper active site geometry

  • Interface residues: Those involved in potential protein-protein interactions

Through systematic mutation of these residues and careful characterization of the resulting variants, researchers can develop a detailed understanding of the molecular basis for plsY activity and specificity in Shewanella species.

What are common challenges in purifying active recombinant Shewanella plsY and how can they be addressed?

Purification of active recombinant Shewanella plsY presents several challenges due to its membrane-associated nature. The following table outlines common issues and recommended solutions:

ChallengeManifestationSolution Strategy
Poor solubilityLow yield after lysis; protein in inclusion bodiesOptimize detergent selection (test DDM, CHAPS, Triton); use lower induction temperature (15°C)
Loss of activity during purificationReduced enzymatic activity despite good protein yieldMaintain anaerobic conditions during purification; add stabilizing agents (glycerol, reducing agents)
Aggregation during concentrationVisible precipitation; increased turbidityAdd 5-10% glycerol; keep protein concentration <2 mg/mL; use gentle concentration methods
Metal contamination affecting activityInconsistent activity measurementsInclude 1 mM EDTA in early purification steps; add 1 mM TCEP to maintain reducing environment
His-tag interferenceActivity lower than expectedInclude TEV protease cleavage step to remove tag; optimize tag position (N vs C-terminal)
Co-purifying contaminantsMultiple bands on SDS-PAGEAdd imidazole wash steps (10-40 mM) during IMAC purification; consider second purification step (ion exchange, gel filtration)

A recommended purification protocol based on successful approaches for similar membrane-associated enzymes includes:

  • Cell lysis in anaerobic conditions using Bug Buster concentrate (1×) in Tris-HCl buffer (pH.7.5) containing 150 mM NaCl, 0.1% Triton, and 5% glycerol

  • Addition of 1 mM TCEP as a reducing agent during lysis

  • Affinity purification using Ni-NTA resin with carefully optimized imidazole concentrations

  • Optional tag removal using TEV protease (if a cleavage site is included)

  • Size exclusion chromatography as a polishing step

  • Storage in buffer containing 6% trehalose at pH 8.0 for maximum stability

This optimized approach addresses the major challenges in obtaining pure, active enzyme suitable for detailed biochemical and structural characterization.

How can computational approaches enhance understanding of Shewanella plsY structure and function?

Computational approaches provide valuable insights into Shewanella plsY structure and function, especially when experimental structural data is limited. An integrated computational strategy includes:

Homology Modeling and Structural Analysis:

  • Generate 3D models using related crystallized proteins as templates

  • Refine models using molecular dynamics simulations in membrane environments

  • Identify putative active site residues through structural analysis

  • Visualize models using PyMOL v2.3.4 or similar software to examine proximity of variable residues to the substrate binding site

Molecular Docking and Binding Studies:

  • Perform substrate docking to predict binding modes of various acyl-phosphate donors

  • Calculate binding energies to explain substrate preferences

  • Identify key residue-substrate interactions that determine specificity

  • Use docking results to guide mutagenesis experiments by predicting which residue changes might alter specificity

Sequence-Based Analyses:

  • Conduct multiple sequence alignments across Shewanella species to identify conserved and variable regions

  • Use conservation analysis to infer functionally important residues

  • Apply evolutionary analysis to understand selective pressures on plsY genes

  • Identify co-evolving residues that may function together in substrate recognition or catalysis

Molecular Dynamics Simulations:

  • Simulate enzyme behavior in membrane environments

  • Analyze conformational changes during substrate binding

  • Investigate the effects of mutations on protein stability and dynamics

  • Model the impact of environmental factors (pH, ionic strength) on enzyme function

Integration with Experimental Data:

  • Use computational predictions to design targeted mutagenesis experiments

  • Refine computational models based on experimental results

  • Develop structure-function hypotheses that can be experimentally tested

  • Create a feedback loop between computational predictions and experimental validation

These complementary computational approaches can significantly accelerate understanding of Shewanella plsY function and guide experimental design for more efficient research progress.

What are the differences in plsY enzymes across various Shewanella species and how do they affect experimental approaches?

The genus Shewanella encompasses diverse species with varying physiological and biochemical characteristics. These differences extend to their plsY enzymes, which show important variations that influence experimental design and interpretation:

Comparative Analysis of plsY Across Shewanella Species:

SpeciesGenome SizeKey plsY CharacteristicsEnvironmental NicheExperimental Considerations
S. oneidensis MR-15.1 MbWell-characterized plsY; model organismFreshwater; metal-reducingExtensive genetic tools available; preferred for initial studies
S. sediminis5.5 MbDistinct substrate preferences; cold-adapted enzymeMarine sediments; psychrophilicExpression at lower temperatures (10-15°C); requires special buffers
S. fidelis H76VariableRecently characterized; unique featuresMediterranean environmentsUnique expression challenges; biofilm formation may affect purification
S. algidipiscicola H111Smaller genomeFewer accessory enzymes; efficient functionMediterranean environmentsSimpler system for studying core function; potentially higher stability
Shewanella sp. (generic)4.5-5.5 MbConserved core structure with variable surface residuesDiverse aquatic environmentsExpression system must be tailored to specific species origin

Key Differences Affecting Experimental Approaches:

  • Sequence Variation:

    • While the core catalytic residues of plsY are conserved, surface residues vary considerably between species

    • Sequence analysis reveals 90-99.5% similarity in 16S rRNA genes but significant differences in protein-coding genes (79-87.6% similarity in gyrB)

    • These differences necessitate species-specific optimization of expression conditions

  • Temperature Adaptations:

    • Psychrophilic Shewanella species produce cold-adapted plsY enzymes that denature at moderate temperatures

    • Mesophilic species have more temperature-stable variants

    • Expression and activity assays must account for these temperature preferences

  • Substrate Preferences:

    • Different Shewanella species show varying preferences for acyl chain length and saturation

    • Experimental design must include appropriate substrate panels to fully characterize enzyme behavior

  • Expression Challenges:

    • Species-specific codon usage may require optimization for heterologous expression

    • Some variants form inclusion bodies more readily than others

    • Co-expression requirements differ between species

These differences highlight the importance of selecting appropriate experimental conditions based on the specific Shewanella species being studied, rather than applying a one-size-fits-all approach to plsY characterization.

How can Shewanella plsY be engineered for biotechnological applications?

The unique properties of Shewanella plsY present several opportunities for engineering the enzyme for biotechnological applications:

Potential Engineering Strategies:

Potential Biotechnological Applications:

  • Bioremediation:

    • Engineered plsY variants could be incorporated into Shewanella strains for enhanced survival in contaminated environments

    • Similar to how S. fidelis H76 and S. algidipiscicola H111 show chromate resistance and reduction capabilities, engineered plsY could contribute to membrane adaptation in toxic environments

  • Lipid Bioengineering:

    • Modified plsY enzymes could produce novel phospholipids with unusual fatty acid compositions

    • Engineered substrate specificity could enable incorporation of industrially valuable fatty acids into phospholipids

  • Biosensor Development:

    • plsY activity could be coupled to reporter systems for detection of specific acyl-phosphates

    • Engineered specificity could allow targeted detection of particular compounds

  • Biocatalysis:

    • Engineered plsY variants could catalyze synthesis of valuable lysophosphatidic acid derivatives

    • Cold-adapted variants from psychrophilic Shewanella species could enable low-temperature biocatalysis

The engineering approaches would benefit from the methodologies demonstrated in related enzyme systems, such as the site-directed mutagenesis and functional characterization approaches used for reductive dehalogenases .

What role might plsY play in the adaptation of Shewanella species to extreme environments?

Shewanella species are known for their remarkable ability to adapt to diverse and often extreme environments, from deep-sea cold habitats to metal-contaminated sites. The plsY enzyme plays a crucial role in this adaptability through several mechanisms:

Membrane Lipid Composition Regulation:

  • Cold Adaptation:

    • In psychrophilic Shewanella species, plsY may preferentially incorporate unsaturated fatty acids into membrane phospholipids

    • This increases membrane fluidity at low temperatures, maintaining cellular function

    • Structural adaptations in plsY from cold-adapted species likely allow function at lower temperatures

  • Pressure Adaptation:

    • Deep-sea Shewanella modify membrane composition to resist high hydrostatic pressure

    • plsY variants may incorporate specific fatty acids that create pressure-resistant membranes

  • Metal Resistance:

    • Shewanella strains like S. fidelis H76 and S. algidipiscicola H111 demonstrate remarkable chromate resistance

    • The membrane composition regulated by plsY likely contributes to metal ion exclusion or detoxification

    • Biofilm formation, which is enhanced in these strains, may involve specific membrane adaptations mediated by plsY

Experimental Evidence and Future Research:

The observation that S. algidipiscicola H111, despite its smaller genome and absence of several genes encoding known chromate resistance enzymes, exhibits superior chromate resistance suggests that fundamental cellular processes like membrane phospholipid synthesis may play unexpected roles in environmental adaptation . Future research directions should include:

  • Comparative analysis of plsY activity and substrate preference across Shewanella species from diverse environments

  • Investigation of membrane lipid profiles in response to environmental stressors

  • Direct assessment of plsY expression levels under different stress conditions

  • Engineering of plsY to enhance adaptation to specific extreme conditions

Understanding the role of plsY in environmental adaptation could inform both basic microbial physiology and applied fields such as bioremediation, where Shewanella strains show promise for applications such as chromate reduction in contaminated sites .

How do the unique properties of Shewanella plsY compare to homologous enzymes from other bacterial species?

Shewanella plsY exhibits several distinctive features when compared to homologous enzymes from other bacterial species, providing insights into both evolutionary adaptations and potential unique applications:

Comparative Analysis of plsY Across Bacterial Phyla:

Bacterial GroupRepresentative SpeciesKey plsY CharacteristicsDistinctive Features
Gammaproteobacteria (Shewanella)Shewanella sp.203 amino acids; membrane-integrated; adaptable to diverse environmentsUnique substrate preferences; cold-adapted variants; functions in high-pressure environments
Other GammaproteobacteriaE. coliHighly characterized; model systemHigher temperature optimum; narrower substrate range; well-studied regulatory mechanisms
FirmicutesBacillus subtilisAlternative acyltransferase pathways may dominateDifferent membrane architecture (more rigid); distinct substrate preferences
ActinobacteriaMycobacterium speciesModified for unique cell wall architecturePreference for longer, more complex acyl chains; involved in specialized lipid synthesis
CyanobacteriaSynechocystis sp.Adapted for photosynthetic membranesUnique regulation tied to photosynthetic activity; different lipid preferences

Distinctive Properties of Shewanella plsY:

These distinctive features make Shewanella plsY an interesting subject for comparative enzymology studies and suggest potential applications where its unique properties could be advantageous, such as cold-active biocatalysis or engineering membrane adaptation for extreme environments.

Understanding these differences requires advanced experimental approaches including:

  • Detailed kinetic comparisons using standardized substrates and conditions

  • Structural studies to identify the molecular basis for distinctive properties

  • Complementation studies in heterologous hosts to assess functional conservation

Such comparative studies could yield valuable insights into both the fundamental biochemistry of phospholipid synthesis and potential biotechnological applications of these versatile enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.