Recombinant Shewanella sediminis Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnE; Ssed_0921; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Shewanella sediminis (strain HAW-EB3)
Target Names
arnE
Target Protein Sequence
MTTFLLFVLSVFSSSMSQYWQKRAAMLFAMQPDLRPLQKLFSRPLILSVFFLGVGAMTWL GVLSVWDVSMAYPLLSINFVIMLLLSHYVFNEPISVRQWIGITLIMLGVIFLAGGEQWLI
Uniprot No.

Target Background

Function
This protein translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasm to the periplasm.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella sediminis and why is it significant for environmental biotechnology?

Shewanella sediminis is a psychrophilic (cold-loving) bacterium isolated from marine sediments. It has gained significant attention in environmental biotechnology due to its versatile electron-accepting capabilities and complex electron transfer network primarily composed of c-type cytochromes and iron-sulfur proteins . The organism is particularly notable for its ability to link the flux of organohalogens to organic carbon via reductive dehalogenation in marine sediments . This metabolic capability makes S. sediminis a potentially important player in natural bioremediation processes in marine environments where halogenated compounds may accumulate.

The significance of S. sediminis extends beyond basic microbiology into applied environmental sciences, as it represents one of the first well-characterized sediment-dwelling Shewanella species capable of reductive dechlorination of compounds like tetrachloroethene (PCE) . This ability to transform chlorinated pollutants into less harmful compounds suggests potential applications in engineered bioremediation strategies for contaminated marine sediments.

What reductive dehalogenases have been identified in Shewanella sediminis and how are they characterized?

Genome sequencing of Shewanella sediminis strain HAW-EB3 has revealed the presence of five putative reductive dehalogenase (Rdh) genes . Through systematic genetic analysis and functional studies, researchers have determined that among these five candidates, the gene Ssed_3769 encodes a functional reductive dehalogenase that catalyzes the dechlorination of tetrachloroethene (PCE) to trichloroethene (TCE) .

Characterization methodology involves:

  • Creation of in-frame deletion mutants for each putative Rdh gene

  • Enzymatic assays using cell extracts with reduced methyl viologen as an electron donor

  • Analysis of PCE transformation to TCE using appropriate analytical techniques

  • Complementation studies to confirm gene function

The specific activity of the PCE dehalogenase in cell extracts of pyruvate/fumarate-grown S. sediminis has been measured at approximately 1 nmol TCE min⁻¹ (mg protein)⁻¹ . Kinetic analysis has shown that the dechlorination of PCE follows Michaelis-Menten kinetics with an apparent Kₘ of 120 μM PCE .

How does growth media composition affect reductive dehalogenase activity in S. sediminis?

The composition of growth media significantly impacts the reductive dehalogenase activity in Shewanella sediminis. Experimental evidence demonstrates two critical factors:

  • Cyanocobalamin requirement: No PCE dechlorination activity is observed when cyanocobalamin (vitamin B12) is omitted from the growth medium . This indicates that the reductive dehalogenase is likely a cobalamin-dependent enzyme, which is consistent with many other characterized reductive dehalogenases from various bacteria.

  • PCE induction effect: The presence of PCE in the growth medium increases PCE transformation rates . This suggests that expression of the reductive dehalogenase may be induced or upregulated in response to the presence of its substrate, representing a form of substrate-dependent regulation.

These findings have important methodological implications for researchers working with S. sediminis, as they highlight the necessity of including appropriate cofactors and potential inducers in growth media to observe optimal dehalogenase activity. Standard cultivation protocols should therefore include cyanocobalamin supplementation, and experimental designs should consider whether pre-exposure to PCE or other potential substrates may affect enzyme activity measurements.

What methods are most effective for constructing gene deletion mutants in Shewanella sediminis for reductive dehalogenase studies?

For effective genetic manipulation of Shewanella sediminis to study reductive dehalogenases, researchers have established a systematic protocol using homologous recombination techniques . The methodology involves the following detailed steps:

  • Target gene selection and primer design: Design primers to amplify approximately 750 bp upstream and downstream fragments of the target gene.

  • PCR amplification and fragment joining:

    • Amplify the upstream and downstream regions from wild-type (AS1028) genomic DNA

    • Join these fragments via complementary tags added to the 5'-end of each inner primer

    • This approach results in an in-frame deletion where only the start and stop codons of the target gene remain

  • Vector construction:

    • Ligate the fusion products into an appropriate vector (e.g., pDS3.0)

    • Verify the construct by sequencing to ensure accurate deletion design

  • Transformation and selection:

    • Introduce the vector into S. sediminis using appropriate transformation methods

    • Select transformants using suitable antibiotics

    • Confirm successful deletions via PCR verification and/or sequencing

  • Complementation studies:

    • For verification of gene function, reintroduce the deleted gene (e.g., Ssed_3769) back into the deletion mutant

    • This "knock-in" approach confirms that any observed phenotypic changes are due specifically to the gene deletion

This genetic manipulation protocol has been successfully applied to create deletion mutants for all five putative reductive dehalogenase genes in S. sediminis (Ssed_1729, Ssed_2100, Ssed_2103, Ssed_3769, and Ssed_4120) . The methodology allows for precise genetic analysis of gene function without the complications of polar effects on downstream genes that can occur with insertion-based mutagenesis approaches.

How do the kinetic properties of the Ssed_3769 reductive dehalogenase compare with other characterized dehalogenases?

The reductive dehalogenase encoded by Ssed_3769 in Shewanella sediminis exhibits distinct kinetic properties that position it among the characterized dehalogenases from various organisms. Key kinetic parameters and comparative analysis include:

  • Kinetic Parameters of Ssed_3769:

    • The enzyme follows Michaelis-Menten kinetics for PCE dechlorination

    • Apparent Kₘ value: 120 μM for PCE

    • Specific activity: approximately 1 nmol TCE min⁻¹ (mg protein)⁻¹ in cell extracts

  • Comparative Analysis:
    The Kₘ value of 120 μM for PCE is within the range reported for other reductive dehalogenases, though specific comparison values aren't provided in the search results. The specific activity of 1 nmol TCE min⁻¹ (mg protein)⁻¹ is relatively modest compared to some highly specialized dehalogenating organisms, which may reflect the fact that S. sediminis is not a dedicated organohalide-respiring bacterium but rather a versatile marine bacterium with diverse metabolic capabilities.

  • Cofactor Requirements:
    Like many reductive dehalogenases, the Ssed_3769 enzyme appears to be cobalamin-dependent, as evidenced by the absence of activity when cyanocobalamin is omitted from the growth medium . This characteristic is shared with many well-characterized reductive dehalogenases from Dehalococcoides, Desulfitobacterium, and other dehalogenating bacteria.

  • Substrate Range:
    The available data focuses on PCE dechlorination to TCE, and complete information about the enzyme's activity on other halogenated substrates is not provided in the search results.

Researchers investigating the Ssed_3769 reductive dehalogenase should conduct comprehensive substrate range testing and detailed kinetic analyses to fully characterize this enzyme relative to other dehalogenases, particularly those from marine environments.

What is the ecological significance of reductive dehalogenases in marine sediment-dwelling Shewanella species?

The presence and activity of reductive dehalogenases in marine sediment-dwelling Shewanella species like S. sediminis have profound ecological implications:

  • Biogeochemical Cycling:
    Reductive dehalogenases in Shewanella sediminis likely play a significant role in the natural cycling of halogenated organic compounds in marine environments. These enzymes can link the flux of organohalogens to organic carbon via reductive dehalogenation in marine sediments . This represents an important biogeochemical process that may influence carbon and halogen cycling in marine ecosystems.

  • Natural Attenuation of Pollutants:
    The ability of S. sediminis to dechlorinate compounds like PCE suggests these organisms contribute to natural attenuation processes in marine environments contaminated with halogenated pollutants. This natural bioremediation capacity may help explain the fate of anthropogenic halogenated compounds that enter marine ecosystems.

  • Adaptation to Marine Chemical Ecology:
    Many marine organisms produce halogenated secondary metabolites as defense compounds or signaling molecules. The reductive dehalogenases in S. sediminis may have evolved in response to these naturally occurring organohalogens, allowing the bacterium to detoxify these compounds or utilize them as alternative electron acceptors in anaerobic respiration.

  • Evolutionary Considerations:
    The presence of five putative reductive dehalogenase genes in the S. sediminis genome suggests evolutionary diversification of these functions, potentially reflecting adaptation to different halogenated substrates present in its native environment. This gene expansion might indicate the ecological importance of organohalide transformation in the evolutionary history of this organism.

These ecological roles highlight why studying reductive dehalogenases in marine Shewanella species provides valuable insights into both natural biogeochemical processes and potential bioremediation applications in marine environments.

What are the optimal conditions for expressing and assaying recombinant reductive dehalogenases from S. sediminis?

Based on the available research data, the following protocol represents the optimal conditions for expressing and assaying recombinant reductive dehalogenases from Shewanella sediminis:

Expression Conditions:

  • Growth Medium: Use a pyruvate/fumarate-based medium supplemented with cyanocobalamin (vitamin B12) . The presence of cyanocobalamin is critical as no PCE dechlorination is observed when it is omitted from the growth medium.

  • Substrate Induction: Consider including PCE in the growth medium as its presence has been shown to increase PCE transformation rates, suggesting potential induction of the dehalogenase expression .

  • Temperature: As S. sediminis is psychrophilic (cold-loving), optimal growth and expression likely occur at lower temperatures than standard mesophilic bacteria, though the exact temperature optimum is not specified in the search results.

Assay Conditions:

  • Electron Donor: Use reduced methyl viologen as the electron donor for the enzymatic assay . This artificial electron donor has been successfully employed in assays with cell extracts of S. sediminis.

  • Substrate Concentration: For kinetic measurements, utilize a range of PCE concentrations that allows for determination of Michaelis-Menten parameters. The Kₘ value has been reported as approximately 120 μM PCE .

  • Activity Measurement: Monitor the formation of TCE as the primary product of PCE dechlorination. The specific activity under optimal conditions has been measured at approximately 1 nmol TCE min⁻¹ (mg protein)⁻¹ .

  • Controls: Always include appropriate controls:

    • Heat-denatured extract (negative control)

    • Wild-type extract (positive control)

    • Extracts from specific gene deletion mutants (e.g., ΔSsed_3769) to confirm gene-function relationships

By following these experimentally validated conditions, researchers can effectively express and assay the reductive dehalogenase activity from S. sediminis, facilitating comparative studies and further characterization of these environmentally significant enzymes.

How can researchers differentiate between the functions of the five putative reductive dehalogenases in S. sediminis?

Differentiating between the functions of the five putative reductive dehalogenases in Shewanella sediminis requires a comprehensive experimental approach combining genetic, biochemical, and analytical techniques:

1. Systematic Gene Deletion Strategy:
Create individual in-frame deletion mutants for each of the five putative reductive dehalogenase genes (Ssed_1729, Ssed_2100, Ssed_2103, Ssed_3769, and Ssed_4120) . This approach has already demonstrated that only deletion of Ssed_3769 results in the loss of PCE dechlorination activity, suggesting its specific role in this transformation .

2. Complementation Analysis:
Confirm gene-function relationships through complementation studies by reintroducing the deleted genes into their respective mutants. This has been successfully demonstrated with strain AS1034, where Ssed_3769 was reintroduced into the ΔSsed_3769 mutant .

3. Substrate Range Testing:
Test each wild-type strain and deletion mutant with a diverse panel of halogenated substrates beyond PCE, including:

  • Other chlorinated ethenes (TCE, DCE isomers, vinyl chloride)

  • Chlorinated benzenes and phenols

  • Brominated and iodinated compounds

  • Chlorinated aliphatics (chloroalkanes)

This approach may reveal distinct substrate preferences for each reductive dehalogenase.

4. Expression Analysis:
Employ quantitative RT-PCR or RNA-seq to determine if the five reductive dehalogenase genes are differentially expressed in response to different:

  • Halogenated substrates

  • Redox conditions

  • Carbon sources

  • Temperature regimes

5. Protein Purification and Biochemical Characterization:
For definitive functional differentiation, purify each reductive dehalogenase and characterize:

  • Substrate specificity profiles

  • Kinetic parameters (Kₘ, Vₘₐₓ, kcat)

  • Cofactor requirements

  • Optimal pH and temperature

  • Inhibition patterns

6. Structural Analysis:
Compare predicted protein structures to identify structural features that might explain functional differences between the five dehalogenases.

By systematically applying these complementary approaches, researchers can comprehensively differentiate between the functions of the five putative reductive dehalogenases in S. sediminis and develop a detailed understanding of their respective ecological and biochemical roles.

How does the ArnE flippase subunit in E. coli relate to proteins found in Shewanella sediminis?

The relationship between the ArnE flippase subunit in E. coli and proteins in Shewanella sediminis represents an interesting comparative genomic question. Based on the available search results, we can provide the following analysis:

The search results include information about a computed structure model of the probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE from Escherichia coli O139:H28 str. E24377A (UniProtKB: A7ZP76) . This model was released in AlphaFold DB with a relatively high confidence score (pLDDT global: 88.62) , indicating a reliable predicted structure.

  • Conduct Comparative Sequence Analysis:
    Perform BLAST or similar sequence alignment searches to identify potential ArnE homologs in the S. sediminis genome.

  • Examine Genomic Context:
    In E. coli, the ArnE protein is part of the arn operon involved in lipopolysaccharide modification pathways that contribute to antimicrobial peptide resistance. Examining whether similar genomic arrangements exist in S. sediminis could provide functional insights.

  • Consider Evolutionary Divergence:
    As E. coli (a gamma-proteobacterium) and Shewanella (also in gamma-proteobacteria) share evolutionary history, they likely possess homologous membrane transport systems, potentially including flippase functions similar to ArnE.

  • Functional Consideration:
    The main role of ArnE in E. coli involves facilitating the transport of modified arabinose across the cytoplasmic membrane for incorporation into lipopolysaccharide, which contributes to antimicrobial resistance. S. sediminis, as a marine bacterium, may have evolved different membrane modification systems adapted to its environment.

It's important to note that while the user query appears to connect the ArnE flippase subunit with Shewanella sediminis, the available search results do not provide evidence for this specific association. The reductive dehalogenase activity identified in S. sediminis (through the Ssed_3769 gene) represents a distinct function from the flippase activity of ArnE proteins, highlighting the need for careful distinction between these different protein families and functions.

What can be inferred about the regulation of reductive dehalogenase genes in the context of the Crp regulon in S. sediminis?

The search results provide a list of genes in the Crp (cAMP receptor protein) regulon of Shewanella sediminis HAW-EB3 , which offers insights into potential regulatory mechanisms for reductive dehalogenase genes:

  • Regulatory Context Analysis:
    The Crp regulon in S. sediminis appears to be extensive, comprising 216 genes according to the search results . This indicates that cAMP-dependent regulation via Crp is a major regulatory mechanism in this organism, consistent with its role in global carbon metabolism regulation in many bacteria.

  • Potential Inclusion of Dehalogenase Genes:
    From the search results, it's not immediately clear whether any of the five putative reductive dehalogenase genes (Ssed_1729, Ssed_2100, Ssed_2103, Ssed_3769, or Ssed_4120) are directly listed as members of the Crp regulon. Researchers would need to specifically check these gene IDs against the provided list .

  • Metabolic Integration Hypothesis:
    If reductive dehalogenase genes are under Crp regulation, this would suggest integration of dehalogenation activities with the organism's broader carbon metabolism, potentially linking halogen respiration to carbon source availability. This would make ecological sense for a versatile marine bacterium like S. sediminis.

  • Experimental Approach for Verification:
    To directly investigate Crp regulation of reductive dehalogenases, researchers could:

    • Analyze the promoter regions of the five reductive dehalogenase genes for potential Crp binding sites

    • Perform gene expression studies comparing wild-type and crp deletion mutants

    • Conduct chromatin immunoprecipitation (ChIP) experiments to detect direct Crp binding to dehalogenase gene promoters

    • Measure dehalogenase activity under conditions that alter cellular cAMP levels

  • Broader Regulatory Network Considerations:
    Given that PCE in the growth medium increases PCE transformation rates , there may be substrate-specific regulation in addition to potential Crp-mediated regulation. This suggests a complex regulatory network integrating multiple environmental signals to control dehalogenase expression.

What is the current state of knowledge about S. sediminis strains and mutants used in reductive dehalogenase research?

The following table summarizes the key S. sediminis strains and mutants that have been developed and characterized for reductive dehalogenase research:

Strain IDDescriptionKey CharacteristicsReference
AS1028Shewanella sediminis strain HAW-EB3, wild-type (WT)Contains five putative reductive dehalogenase genes; exhibits PCE dechlorination activity
AS1029In-frame deletion of Ssed_4120 in AS (WT), ΔSsed_4120Retains PCE dechlorination activity
AS1030In-frame deletion of Ssed_3769 in AS (WT), ΔSsed_3769Loss of PCE dechlorination activity
AS1031In-frame deletion of Ssed_2100 in AS (WT), ΔSsed_2100Retains PCE dechlorination activity
AS1032In-frame deletion of Ssed_2103 in AS (WT), ΔSsed_2103Retains PCE dechlorination activity
AS1033In-frame deletion of Ssed_1729 in AS (WT), ΔSsed_1729Retains PCE dechlorination activity
AS1034AS1030 complemented with Ssed_3769 by knock-in, Ssed_3769+Restored PCE dechlorination activity

This systematic collection of deletion mutants has provided critical evidence that among the five putative reductive dehalogenase genes in S. sediminis, only Ssed_3769 encodes a functional PCE reductive dehalogenase under the tested conditions . The complementation strain (AS1034) further confirms this finding by demonstrating that reintroduction of the Ssed_3769 gene restores the PCE dechlorination capability.

These genetic resources provide a foundation for further research into the biochemical properties, substrate specificities, and regulatory mechanisms of reductive dehalogenases in S. sediminis. Future research directions might include creating double or multiple deletion mutants to investigate potential redundancy or interactions between the different reductive dehalogenase genes under varied environmental conditions.

What are the key experimental parameters for assaying reductive dehalogenase activity in S. sediminis?

The following table summarizes the critical experimental parameters for accurately assaying reductive dehalogenase activity in Shewanella sediminis based on published research:

Parameter CategorySpecific ConditionsNotesReference
Growth Medium RequirementsPyruvate/fumarate-based mediumSupports optimal growth and enzyme expression
Cyanocobalamin (vitamin B12) supplementationEssential - no PCE dechlorination observed without it
PCE addition (optional)Increases PCE transformation rates, suggesting induction
Enzyme Assay ConditionsReduced methyl viologenServes as artificial electron donor
PCE as substratePrimary substrate for characterized activity
Concentration range around 120 μM PCEBased on determined Kₘ value
Activity MeasurementTCE formation monitoringPrincipal product of PCE dechlorination
Specific activity: ~1 nmol TCE min⁻¹ (mg protein)⁻¹Baseline expected activity level in cell extracts
Essential ControlsHeat-denatured extractNegative control - confirms enzymatic nature
Wild-type (AS1028) extractPositive control
ΔSsed_3769 mutant (AS1030)Negative control for PCE dechlorination
Complemented strain (AS1034)Confirms gene-function relationship
Kinetic ParametersMichaelis-Menten kineticsEnzymatic behavior model
Kₘ = 120 μM for PCESubstrate affinity measure

These parameters provide a standardized framework for researchers investigating reductive dehalogenase activity in S. sediminis. Adherence to these conditions enables reliable detection and quantification of enzyme activity, facilitates comparison between different studies, and provides a foundation for exploring variations in experimental conditions to further characterize these environmentally significant enzymes.

Researchers should note that these parameters specifically apply to PCE dechlorination activity. Investigation of other potential substrates may require modified conditions and analytical methods appropriate for detecting different dehalogenation products.

What are the most promising research opportunities related to S. sediminis reductive dehalogenases?

Based on current knowledge and research gaps identified in the available literature, several high-priority research opportunities exist for advancing our understanding of Shewanella sediminis reductive dehalogenases:

  • Comprehensive Substrate Range Characterization
    The current literature primarily focuses on PCE dechlorination , but a systematic evaluation of the substrate range for Ssed_3769 and potential activities of the other four putative reductive dehalogenases would provide critical insights into their environmental roles. This should include testing against diverse halogenated compounds including brominated and iodinated analogues that might be more relevant in marine environments.

  • Structural Biology Investigations
    Determining the crystal structure of Ssed_3769 would provide fundamental insights into the catalytic mechanism of this reductive dehalogenase. Comparative structural analysis with the available AlphaFold models of related proteins could reveal unique features of marine dehalogenases versus terrestrial counterparts.

  • Investigation of Ecological Relevance
    Field studies examining the expression and activity of S. sediminis reductive dehalogenases in native marine sediment environments would help establish their ecological significance. This should include analysis of natural substrate availability and in situ dehalogenation rates.

  • Regulatory Network Elucidation
    Detailed investigation of how the five reductive dehalogenase genes are regulated in response to environmental factors, including potential integration with the Crp regulon , would provide insights into their physiological roles and evolutionary adaptations.

  • Protein Engineering for Enhanced Activity
    Structure-guided protein engineering could potentially enhance the catalytic efficiency, substrate range, or stability of Ssed_3769, creating improved biocatalysts for environmental applications.

  • Comparative Genomics Across Marine Shewanella Species
    Expanding the analysis to include reductive dehalogenase homologs across the Shewanella genus could reveal patterns of evolutionary adaptation and specialization for different marine environments.

  • Development of Biosensors Based on S. sediminis Dehalogenases
    The substrate specificity of Ssed_3769 could potentially be exploited to develop biosensors for detecting specific halogenated compounds in environmental samples.

These research directions would collectively advance our understanding of the biochemical, ecological, and evolutionary aspects of reductive dehalogenases in S. sediminis, potentially leading to practical applications in environmental monitoring, bioremediation, and green chemistry.

What methodological challenges must be addressed to advance research on recombinant expression of S. sediminis proteins?

Researchers face several significant methodological challenges when working with recombinant expression of proteins from Shewanella sediminis, particularly reductive dehalogenases. Addressing these challenges requires innovative approaches:

  • Cold-Adapted Protein Expression Systems
    As S. sediminis is psychrophilic , its proteins may be adapted to function at lower temperatures. Standard expression systems (e.g., E. coli at 37°C) might result in misfolding or formation of inclusion bodies. Development of cold-adapted expression hosts or cold-induction systems would be beneficial.

    Recommended approach: Evaluate expression in psychrophilic hosts or using cold-shock promoters in mesophilic systems, with temperature optimization between 10-20°C during the induction phase.

  • Cofactor Incorporation
    The reductive dehalogenase activity in S. sediminis is dependent on cyanocobalamin (vitamin B12) , suggesting the enzyme requires corrinoid cofactors. Ensuring proper cofactor incorporation during recombinant expression is challenging.

    Recommended approach: Supplement expression media with cyanocobalamin and potentially co-express corrinoid trafficking proteins that might be needed for proper cofactor incorporation.

  • Membrane Association Challenges
    Many reductive dehalogenases contain transmembrane domains or associate with membrane complexes, making their soluble expression difficult. Similarly, the ArnE protein from E. coli is a membrane protein (flippase) , suggesting homologs in S. sediminis would share this characteristic.

    Recommended approach: Utilize specialized membrane protein expression systems, detergent screening, or express soluble catalytic domains when full-length expression proves challenging.

  • Oxygen Sensitivity
    Reductive dehalogenases typically contain oxygen-sensitive iron-sulfur clusters and operate under anaerobic conditions. Maintaining anaerobic conditions during expression and purification is technically demanding.

    Recommended approach: Implement strict anaerobic techniques throughout the expression and purification process, including the use of oxygen scavengers and anaerobic chambers.

  • Genetic Code Optimization
    S. sediminis, as a marine bacterium, may have codon usage patterns that differ from common expression hosts, potentially leading to translation inefficiency or premature termination.

    Recommended approach: Optimize codon usage for the expression host while maintaining critical structural features of the native protein.

  • Functional Assay Development
    Developing sensitive and specific assays for recombinant proteins is crucial. For reductive dehalogenases, this requires specialized analytical techniques to detect dehalogenation products.

    Recommended approach: Establish robust analytical methods such as gas chromatography or HPLC-based assays capable of detecting chlorinated compounds at low concentrations, with appropriate controls to validate enzyme-specific activity.

Addressing these methodological challenges will require interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and analytical chemistry expertise. Success in overcoming these barriers would significantly advance our understanding of S. sediminis proteins and their potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.