Recombinant Shewanella sediminis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Shewanella sediminis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC)

Recombinant Shewanella sediminis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC), also known as Undecaprenyl-phosphate Ara4FN transferase or Ara4FN transferase, is an enzyme involved in modifying the bacterial cell surface . ArnC is a type-2 glycosyltransferase (GT-2) that participates in the formation of UndP-Ara4FN . It is found in Shewanella sediminis and other bacteria . The enzyme is encoded by the arnC gene, also referred to as Ssed_0925 .

Function and Mechanism

ArnC is responsible for the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) to undecaprenyl phosphate (UndP), forming UndP-Ara4FN . UndP is a lipid carrier that transports glycans and glycopolymers across the cytoplasmic membrane in bacteria . The addition of Ara4FN to UndP is a crucial step in the biosynthesis of modified lipopolysaccharides, which can alter bacterial resistance to antimicrobial peptides such as polymyxins .

Biological Significance

The ArnC enzyme plays a crucial role in bacterial resistance to antimicrobial peptides . The modification of lipopolysaccharides with Ara4FN can alter the charge and structure of the bacterial cell surface, reducing the binding affinity of polymyxins and other cationic antimicrobial agents . This mechanism is particularly relevant in bacteria exposed to various environmental stresses or antibiotic treatments .

Role in Shewanella Species

In Shewanella species, ArnC is part of a larger two-component system that responds to changing oxygen levels . Shewanella oneidensis employs a hybrid sensor histidine kinase ArcS, which, along with the response regulator ArcA and the phosphotransfer protein HptA, regulates the response to redox changes . While the precise role of ArnC in this system is not fully elucidated, it is likely involved in adapting the cell surface properties of Shewanella to different environmental conditions .

Homologues in Other Species

ArnC homologues are found in various bacterial species. For example, Salmonella typhimurium ArnC has been structurally characterized using cryo-EM, revealing that it forms a stable tetramer . Deletion of the arnC gene in E. coli decreases the level of UndP-Ara4FN, confirming its role in the formation of UndP-Ara4FN .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; Ssed_0925; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Shewanella sediminis (strain HAW-EB3)
Target Names
arnC
Target Protein Sequence
MKHNQNIDFVSIVIPVYNEEASLPELLSRTLAAADSMGKHYELVLIDDGSRDNSANIIEA AAAEPDSHVVGIILNRNYGQHNAIMAGFEHVRGDLIITLDADLQNPPEEIPNLVAKAEEG YDSVGTVRRHRQDSALRRYPSKLINKLVKRSTGVEMNDYGCMLRAYRRHVVKAMLECHER STFIPILANGFARHTAEIDVHHSERSQGESKYGFMNLINLMFDLLTSMTTAPLRMLSIVG GGIASFGILFGLFLILLRLIYGAEWGVDGVFPLFSILFIFIGAQFVGLGLLGEYIGRIYS DVRARPRYYVQDILVGEATKGARISDENKNN
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is arnC and what is its primary function in bacterial physiology?

ArnC is a glycosyltransferase that functions within the lipid-A modification pathway. In Gram-negative bacteria like Shewanella sediminis, it catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) to undecaprenyl phosphate, which is a crucial step in the modification of lipopolysaccharides (LPS). This modification ultimately contributes to antimicrobial peptide resistance, particularly against polymyxins, by reducing the negative charge of the bacterial outer membrane, thereby decreasing the binding affinity of cationic antimicrobial peptides .

How is the arnC gene organized within the genome of Shewanella sediminis?

In Shewanella sediminis (strain HAW-EB3), the arnC gene is identified as Ssed_0925 in the ordered locus names. The gene encodes a full-length protein of 331 amino acids . The arnC gene typically forms part of the arnBCDTEF operon, which works in concert with pmrE(ugd) loci to mediate LPS modifications that confer polymyxin resistance. While specific operon organization in S. sediminis is not detailed in the provided sources, comparative genomic analysis with other Gram-negative bacteria suggests its integration within a resistance-associated gene cluster .

What are the key structural domains of the arnC protein?

Based on structural analysis of homologous proteins, arnC contains three distinct regions: an N-terminal glycosyltransferase domain responsible for catalytic activity, a transmembrane region that anchors the protein to the membrane, and interface helices (IHs) that mediate protein-protein interactions. The protein forms a stable tetramer with C2 symmetry through interactions in the C-terminal region, which protrudes into the cytosol. The β8 strand of each protomer inserts into the adjacent protomer, stabilizing the quaternary structure through multiple hydrogen bonds and salt bridges .

What are the optimal conditions for recombinant expression of Shewanella sediminis arnC?

For optimal expression of recombinant S. sediminis arnC, a heterologous expression system using E. coli is commonly employed. The protein can be tagged with a 6x-His tag for purification purposes. Expression should be conducted in media supplemented with a comprehensive vitamin solution containing 18 nM cyanocobalamin (vitamin B12), as this cofactor is essential for proper protein folding and function . The expression culture should be maintained under controlled temperature conditions, with induction parameters optimized to prevent formation of inclusion bodies given the membrane-associated nature of arnC.

What purification strategy provides the highest yield and purity of functional arnC?

A multi-step purification protocol is recommended for arnC:

  • Initial capture using Ni-NTA affinity chromatography with buffers containing detergent (e.g., 0.05% [w/v] DDM) to maintain protein solubility

  • Overnight dialysis in the presence of TEV protease to remove the affinity tag

  • Reverse Ni-NTA chromatography to remove uncleaved protein and free tag

  • Amphipol exchange (such as A8-35) at 1:3 protein-to-amphipol ratio to enhance protein stability

  • Bio-bead treatment to remove detergent

  • Size exclusion chromatography using a Superdex 200 column equilibrated in an appropriate buffer system (e.g., 50 mM Tris pH 8.0, 150 mM NaCl, 0.5 mM TCEP)

This protocol, adapted from approaches used for similar membrane proteins, typically yields protein of >90% purity suitable for structural and functional studies .

How can researchers assess the structural integrity of purified arnC?

Assessment of arnC structural integrity should employ multiple complementary approaches:

  • Size exclusion chromatography to confirm tetrameric assembly and homogeneity

  • Circular dichroism spectroscopy to evaluate secondary structure content

  • Thermal shift assays to assess protein stability

  • Limited proteolysis to identify flexible regions and domain organization

  • Activity assays using UDP-Ara4FN as substrate to confirm functional competence

  • For advanced structural characterization, negative-stain electron microscopy can provide initial assessment of particle distribution and homogeneity prior to cryo-EM studies

What enzymatic assays can reliably measure arnC activity in vitro?

ArnC activity can be measured using a coupled enzymatic assay that tracks the transfer of Ara4FN from UDP-Ara4FN to undecaprenyl phosphate. The assay components typically include:

  • Purified arnC protein (1-5 μg)

  • UDP-Ara4FN substrate (50-200 μM)

  • Undecaprenyl phosphate (incorporated into liposomes or micelles, 50-100 μM)

  • Divalent cations (Mn²⁺ or Mg²⁺, 5-10 mM)

  • Buffer system (typically 50 mM HEPES pH 7.5, 100 mM NaCl)

Activity can be monitored either by measuring the release of UDP using a coupled enzymatic assay with UDP-glucose pyrophosphorylase and detection of inorganic phosphate, or by direct detection of the lipid product using chromatographic methods like TLC or LC-MS .

How does substrate concentration affect arnC kinetics, and what are the typical Michaelis-Menten parameters?

While specific kinetic parameters for S. sediminis arnC are not provided in the search results, studies with homologous enzymes from related species demonstrate Michaelis-Menten kinetics. By analogy with other glycosyltransferases and reductive dehalogenases in Shewanella, the enzyme likely exhibits an apparent Km value in the micromolar range (approximately 100-200 μM for primary substrates). Cooperative binding behavior may be observed due to the tetrameric structure, potentially resulting in sigmoidal kinetics rather than classical Michaelis-Menten behavior under certain conditions .

What cofactors are essential for arnC activity and how do they influence catalytic function?

Critical cofactors for arnC activity include:

  • Divalent metal ions (Mn²⁺ or Mg²⁺): These are essential for coordinating the UDP-sugar substrate and facilitating the glycosyl transfer reaction.

  • Cyanocobalamin (vitamin B12): Required during protein expression for proper folding and assembly. The absence of cyanocobalamin in the growth medium has been shown to eliminate enzymatic activity in related Shewanella enzymes .

The binding of UDP induces conformational changes that stabilize the structurally labile A-loop (spanning residues 201-213) and parts of the catalytic pocket formed by interface helices (IH1 and IH2), suggesting an induced-fit mechanism of substrate recognition and catalysis .

What genetic tools are available for creating targeted mutations in the arnC gene of Shewanella sediminis?

For genetic manipulation of Shewanella sediminis arnC, a highly efficient two-plasmid system combining single-stranded DNA oligonucleotide recombineering with CRISPR/Cas9-mediated counter-selection has been developed. This system consists of:

  • A sgRNA targeting vector specific for the arnC locus

  • An editing vector harboring both Cas9 and phage recombinase W3 Beta

This approach enables precise genetic modifications with >90% efficiency among transformed cells, compared to approximately 5% efficiency with recombineering alone. The system allows for the introduction of various genetic changes including point mutations, deletions, and small insertions, providing a versatile tool for investigating arnC function through targeted mutagenesis .

How can researchers generate an arnC knockout strain to study its phenotypic effects?

To generate an arnC knockout strain in S. sediminis, the following approach is recommended:

  • Design sgRNA targeting a unique sequence within the arnC gene

  • Design ssDNA oligonucleotide recombineering template containing 40-60 bp homology arms flanking the target site and incorporating a premature stop codon or frameshift mutation

  • Co-transform cells with the sgRNA targeting vector and editing vector

  • Select transformants on appropriate antibiotics

  • Screen colonies by PCR and sequencing to confirm the desired mutation

  • Assess phenotypic effects by evaluating polymyxin susceptibility using minimum inhibitory concentration (MIC) assays and by analyzing LPS modifications through mass spectrometry

A similar approach using in-frame deletion was successfully employed for investigating other genes in S. sediminis, resulting in strains with specific gene deletions (e.g., AS1030 carrying ΔSsed_3769) .

What complementation strategies verify that observed phenotypes are specifically attributable to arnC disruption?

To verify that observed phenotypes are specifically attributable to arnC disruption, complementation studies should be performed using:

  • Construction of an expression plasmid containing the wild-type arnC gene under the control of its native promoter or an inducible promoter

  • Introduction of this complementation plasmid into the arnC knockout strain

  • Assessment of restored function through:

    • Polymyxin susceptibility testing

    • LPS modification analysis

    • In vitro enzymatic activity assays with cell extracts

    • Growth rate comparisons under selective conditions

The complementation should restore the wild-type phenotype, confirming that the observed effects are specifically due to arnC disruption rather than polar effects or secondary mutations. This approach has been demonstrated in Shewanella for similar genes, ensuring phenotype specificity (as seen with strain AS1034 complementation) .

How does the three-dimensional structure of arnC inform our understanding of its catalytic mechanism?

The three-dimensional structure of arnC, as inferred from homologous proteins, reveals several key features that inform its catalytic mechanism:

  • The enzyme forms a tetramer with C2 symmetry, with the catalytic sites positioned at the interface between protomers.

  • The binding of UDP induces conformational changes in the A-loop (residues 201-213), stabilizing the catalytic pocket formed by interface helices IH1 and IH2.

  • The glycosyltransferase domain contains a nucleotide-sugar binding site with conserved motifs for coordinating the UDP moiety and the Ara4FN sugar.

  • The transmembrane region likely positions the enzyme to access the lipid substrate (undecaprenyl phosphate) within the membrane bilayer.

These structural features support a mechanism where UDP-Ara4FN binding induces conformational changes that optimize the catalytic site for nucleophilic attack by the phosphate group of undecaprenyl phosphate, resulting in the transfer of the Ara4FN moiety and release of UDP .

What bioinformatic approaches can identify critical catalytic residues in arnC?

To identify critical catalytic residues in arnC, researchers should employ a multi-faceted bioinformatic approach:

  • Multiple sequence alignment of arnC homologs across diverse bacterial species to identify conserved residues

  • Structural alignment with homologous glycosyltransferases of known function, such as GtrB and DPMS, to identify structurally conserved catalytic sites

  • Analysis of the UDP binding site to identify residues involved in nucleotide recognition

  • Examination of the A-loop (residues 201-213) that undergoes conformational changes upon substrate binding

  • Molecular docking simulations with UDP-Ara4FN and undecaprenyl phosphate to predict substrate-binding residues

  • Evolutionary conservation analysis to distinguish functionally critical residues from those important for structural integrity

This comprehensive approach enables the identification of residues likely involved in substrate binding, catalysis, and conformational changes, providing targets for site-directed mutagenesis to experimentally validate their functional roles .

How do conformational changes in arnC facilitate catalysis?

Conformational changes in arnC play a crucial role in its catalytic mechanism:

  • The binding of UDP induces stabilization of the structurally labile A-loop (residues 201-213), which transitions from a disordered state to a well-defined conformation.

  • This conformational change organizes the catalytic pocket formed by interface helices IH1 and IH2, positioning key catalytic residues for interaction with the substrates.

  • The tetrameric arrangement likely undergoes subtle quaternary structure rearrangements, as observed in the cryo-EM analysis of homologous proteins.

  • These movements potentially coordinate the cytoplasmic catalytic domain with the membrane-embedded region to facilitate access to both the soluble UDP-Ara4FN substrate and the membrane-embedded undecaprenyl phosphate acceptor.

  • After catalysis, product release may involve additional conformational changes that reset the enzyme for the next catalytic cycle.

These dynamic structural changes highlight the enzyme's induced-fit mechanism and explain the requirement for proper quaternary structure assembly for full catalytic activity .

How does Shewanella sediminis arnC compare structurally and functionally with homologs from other bacterial species?

Structural and functional comparison of S. sediminis arnC with homologs from other bacteria reveals:

What insights can be gained from structural comparisons between arnC and related glycosyltransferases?

Structural comparisons between arnC and related glycosyltransferases provide several important insights:

  • Catalytic mechanism: Comparison with GtrB and DPMS reveals conserved catalytic residues involved in UDP binding and glycosyl transfer, suggesting a common SN2-like displacement mechanism.

  • Substrate specificity determinants: Structural variations in the sugar-binding pocket explain the different substrate specificities observed among these enzymes (Ara4FN for ArnC versus other sugars for homologs).

  • Membrane interaction: Differences in the transmembrane domains reflect adaptations to specific membrane environments and lipid substrates.

  • Quaternary structure: The tetrameric arrangement with C2 symmetry observed in ArnC appears to be a conserved feature that is critical for bringing together the catalytic components.

  • Evolution of function: Structural conservation despite sequence divergence indicates that these enzymes evolved from a common ancestor but adapted to different functional niches within bacterial cell envelope modification pathways .

How do environmental adaptations influence arnC structure and function across different Shewanella species?

Environmental adaptations significantly influence arnC structure and function across Shewanella species:

  • Temperature adaptation: As Shewanella sediminis is psychrophilic (cold-adapted), its arnC likely contains adaptations for activity at lower temperatures compared to mesophilic homologs, potentially including increased flexibility in certain regions and a different balance of stabilizing interactions.

  • Pressure adaptation: Since S. sediminis was isolated from marine sediments, its enzymes may contain adaptations for function under higher pressure conditions, which could influence protein compressibility and volume changes during catalysis.

  • Habitat-specific modifications: The specific composition of LPS modifications may reflect adaptation to marine sediment environments, potentially influencing substrate specificity of arnC.

  • Salt tolerance: Enzymes from marine Shewanella species typically show adaptations for function at higher salt concentrations, which may be reflected in the surface charge distribution and ion-binding sites of arnC.

  • Redox adaptation: As a facultative anaerobe capable of utilizing diverse electron acceptors, S. sediminis may have evolved regulatory mechanisms for arnC expression in response to varying redox conditions, potentially linking LPS modification to its versatile respiratory capabilities .

How does arnC contribute to polymyxin resistance mechanisms, and what are the implications for antimicrobial development?

ArnC plays a crucial role in polymyxin resistance through the following mechanism:

  • As part of the arnBCDTEF operon pathway, arnC catalyzes the transfer of Ara4FN to undecaprenyl phosphate, an essential step in the LPS modification process.

  • This modified lipid carrier subsequently transfers Ara4FN to lipid A, reducing the negative charge of the bacterial outer membrane.

  • The resulting charge neutralization decreases the binding affinity of cationic antimicrobial peptides like polymyxins, conferring resistance.

  • This mechanism represents a critical defense strategy employed by numerous Gram-negative pathogens, including ESKAPE pathogens (Enterococcus faecium, Staphylococcus aureus, Klebsiella pneumoniae, Acinetobacter baumannii, Pseudomonas aeruginosa, and Enterobacter species).

For antimicrobial development, these insights suggest that:

  • ArnC inhibitors could potentially restore polymyxin sensitivity in resistant strains

  • Combination therapies targeting both bacterial killing and resistance mechanisms could enhance polymyxin efficacy

  • Understanding the structural basis of ArnC function opens avenues for structure-based drug design

  • The conservation of this pathway across multiple pathogens suggests that ArnC inhibitors might have broad-spectrum adjuvant potential .

What experimental approaches can evaluate the role of arnC in bacterial adaptation to antimicrobial stress?

To evaluate arnC's role in bacterial adaptation to antimicrobial stress, researchers can employ several experimental approaches:

  • Adaptive laboratory evolution studies:

    • Expose S. sediminis to gradually increasing concentrations of polymyxins

    • Sequence evolved strains to identify mutations in arnC or its regulatory elements

    • Perform transcriptomic analysis to assess changes in arnC expression patterns

  • Reporter gene assays:

    • Construct transcriptional or translational fusions of arnC with reporter genes

    • Monitor expression changes in response to various antimicrobial stresses

    • Identify regulatory elements controlling stress-induced expression

  • Genetic complementation experiments:

    • Introduce S. sediminis arnC into polymyxin-sensitive bacteria lacking functional arnC

    • Assess changes in polymyxin resistance profiles

    • Perform comparative analysis with arnC variants to identify critical functional domains

  • Transposon mutagenesis screens:

    • Identify genetic interactors with arnC that influence polymyxin resistance

    • Map regulatory networks controlling arnC expression

    • Discover potential bypass mechanisms for LPS modification

  • Animal infection models:

    • Compare virulence and persistence of wild-type and arnC mutant strains

    • Evaluate efficacy of polymyxin treatment against each strain

    • Assess in vivo selection for arnC expression

How can arnC structure inform the design of inhibitors to combat antimicrobial resistance?

The structural insights into arnC can guide the rational design of inhibitors through several approaches:

  • Targeting the UDP-Ara4FN binding site:

    • Design competitive inhibitors that mimic the UDP-sugar substrate but cannot be transferred

    • Develop transition state analogs that bind with higher affinity than the natural substrate

    • Create allosteric inhibitors that prevent proper positioning of the UDP-sugar

  • Disrupting tetramer formation:

    • Design peptides or small molecules that interfere with the β8 strand insertion into adjacent protomers

    • Target the C2 symmetry interfaces with compounds that disrupt critical hydrogen bonds and salt bridges

    • Develop compounds that trap the protein in an inactive conformational state

  • Exploiting the A-loop dynamics:

    • Design molecules that bind to and stabilize the A-loop in an inactive conformation

    • Develop compounds that prevent the conformational changes necessary for catalysis

    • Create covalent modifiers that react with key residues in the A-loop

  • Structure-based virtual screening approach:

    • Use the binding pocket geometry to screen virtual libraries for potential binders

    • Employ molecular dynamics simulations to identify transient pockets for inhibitor binding

    • Implement fragment-based approaches to identify chemical scaffolds with optimizable binding properties

By targeting the unique structural features of arnC, these approaches offer promising strategies for developing adjuvants that could restore the effectiveness of polymyxins against resistant Gram-negative pathogens .

What strategies can overcome common challenges in recombinant arnC expression and purification?

When encountering challenges with recombinant arnC expression and purification, researchers should consider the following optimization strategies:

ChallengeOptimization StrategyRationale
Poor expression levelsUse codon-optimized gene sequenceImproves translation efficiency in heterologous host
Test different promoter systems (T7, tac, araBAD)Identifies optimal expression control
Screen multiple E. coli strains (BL21, C41/C43, Rosetta)Different strains have varying tolerance for membrane protein expression
Protein misfoldingAdd 18 nM cyanocobalamin to growth mediumEssential cofactor for proper folding
Lower induction temperature (16-20°C)Slows expression rate, improving folding
Include chemical chaperones (glycerol, trehalose)Stabilizes protein during folding
Poor solubilityScreen multiple detergents (DDM, LMNG, GDN)Identifies optimal solubilizing agent
Test different solubilization conditions (pH, salt, time)Optimizes extraction efficiency
Consider fusion tags (MBP, SUMO)Enhances solubility
Low purityImplement two-step affinity purificationRemoves persistent contaminants
Add imidazole wash steps during IMACReduces non-specific binding
Use ion exchange chromatography as polishing stepSeparates based on charge differences
Protein instabilityReplace detergent with amphipol (A8-35)Provides more stable membrane protein environment
Add stabilizing ligands during purificationBinds active site, enhancing stability
Include glycerol (5-10%) in all buffersPrevents aggregation

Implementation of these strategies, guided by systematic optimization, can significantly improve the yield and quality of purified arnC protein .

How can researchers optimize conditions for crystallization or cryo-EM analysis of arnC?

Optimizing conditions for structural studies of arnC requires careful consideration of multiple factors:

For crystallization attempts:

  • Protein preparation:

    • Ensure >95% purity with minimal heterogeneity

    • Remove flexible regions that might hinder crystal formation

    • Test both tagged and untagged versions of the protein

    • Consider limited proteolysis to identify stable domains

  • Crystallization screening:

    • Use lipidic cubic phase (LCP) for membrane protein crystallization

    • Screen detergent:protein ratios systematically

    • Test co-crystallization with substrates, products, or inhibitors

    • Explore different temperatures (4°C, 16°C, 20°C)

For cryo-EM studies:

  • Sample preparation:

    • Exchange detergent for amphipol A8-35 at 1:3 protein-to-amphipol ratio

    • Remove detergent using Bio-beads

    • Perform size exclusion chromatography in cryogenic buffer (e.g., 50 mM Tris pH 8.0, 150 mM NaCl, 0.5 mM TCEP)

    • Assess sample quality using negative stain EM before proceeding

  • Grid preparation:

    • Optimize protein concentration (typically 0.5-5 mg/ml)

    • Test different grid types (Quantifoil, C-flat)

    • Screen blotting conditions systematically

    • Consider additives like detergents or salts to modify air-water interface behavior

  • Data collection:

    • Collect at high magnification for membrane proteins

    • Use beam-tilt pairs for improved CTF estimation

    • Implement energy filters to enhance contrast

    • Use movie mode with motion correction

These optimized approaches have proven successful for structural determination of related membrane proteins, including the homologous ArnC from Salmonella typhimurium .

What are the key considerations for designing site-directed mutagenesis studies to probe arnC function?

When designing site-directed mutagenesis studies to investigate arnC function, researchers should consider:

  • Target selection rationale:

    • Conserved residues identified through multiple sequence alignments

    • Residues in the predicted UDP binding site based on structural homology

    • A-loop residues (particularly in the 201-213 region) involved in conformational changes

    • Interface residues critical for tetramer formation

    • Transmembrane residues potentially involved in lipid substrate recognition

  • Mutation strategy:

    • Conservative substitutions to probe specific chemical properties (e.g., D→E to maintain charge)

    • Non-conservative substitutions to eliminate specific interactions (e.g., D→A to remove charge)

    • Systematic alanine scanning of specific regions

    • Introduction of bulky residues to test spatial constraints

    • Cysteine substitutions for subsequent chemical modification studies

  • Functional assessment:

    • In vitro activity assays with purified mutant proteins

    • Thermal stability measurements to distinguish catalytic from structural effects

    • Oligomerization state analysis to verify tetramer formation

    • In vivo complementation of arnC knockout strains

    • MIC determination for polymyxin resistance

  • Structural validation:

    • Limited proteolysis to assess conformational changes

    • Substrate binding studies using isothermal titration calorimetry

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamics

    • Structural determination of key mutants when possible

These approaches allow for systematic and comprehensive analysis of structure-function relationships in arnC, providing mechanistic insights into its catalytic activity and role in polymyxin resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.