Recombinant Shewanella sediminis UPF0761 membrane protein Ssed_0302 (Ssed_0302)

Shipped with Ice Packs
In Stock

Description

Biological Source and Significance

Organism:

  • Shewanella sediminis strain HAW-EB3 (DSM 17055) is a psychrophilic, rod-shaped bacterium isolated from Halifax Harbour sediment .

  • Distinctive traits include lysine decarboxylase activity, Na+ dependence, and metabolic versatility (e.g., oxidation of N-acetyl-d-glucosamine) .

Gene and Protein:

  • Gene: Ssed_0302 (Ordered Locus Name) .

  • UniProt ID: A8FPZ2 .

  • Protein Family: UPF0761, a group of uncharacterized membrane proteins conserved across bacterial species .

Recombinant Production and Applications

Expression and Purification:

  • Host System: Not explicitly stated, but typical for recombinant proteins (e.g., E. coli) .

  • Tag: Epitope tag (type determined during production) .

Research Use Cases:

  • Membrane Protein Studies: As a member of the UPF0761 family, Ssed_0302 may serve as a model for studying bacterial membrane protein biogenesis, particularly β-barrel assembly mechanisms involving the BAM complex .

  • Environmental Biotechnology: Given S. sediminis’s pollutant-degrading capabilities, this protein could be investigated for roles in bioremediation pathways .

Comparative Analysis with Related Proteins

FeatureSsed_0302Other UPF0761 Proteins
OrganismShewanella sediminisShewanella baltica, S. woodyi
Gene LocusSsed_0302Shewmr4_0316, Swoo_4618
Sequence Length318 residues250–350 residues
Functional AnnotationMembrane localizationHypothetical membrane proteins

Research Gaps and Future Directions

  • Functional Characterization: No direct studies on Ssed_0302’s enzymatic or structural roles are available.

  • Interaction Mapping: Potential interactions with BAM complex components (e.g., BamA/BamD) remain unexplored .

  • Biotechnological Potential: Links to RDX degradation in S. sediminis warrant investigation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it for you.
Synonyms
Ssed_0302; UPF0761 membrane protein Ssed_0302
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Shewanella sediminis (strain HAW-EB3)
Target Names
Ssed_0302
Target Protein Sequence
MIKKIDGTQLHTFVLSTWHFMIHLKQRLAEDQINIRAGHLAYVTLLSLVPMVAVTMSMLS AFPVFSGIRGQIEGFIYNNFLPAAGDTVQVYINEFVSNASKGTAVGIAALMVVAIMLISA IDKALNNIWRTTEKRSMVVSFSMYWMVLTLGPVLMGASLVATSYVVSLKVFNGSDLSGVV PVLVERLPMFFSVATFLLIYMVVPNIKVKFFHALLGAIVAALLFEFGKKGFAIYLTKFPT YEAIYGALATIPILFMWVYLSWIIVLLGAEITAAMPEYLDKRQSGKDEESEKKAEAHDPQ ISFSISTAVNESKKENRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What experimental design strategies are most effective for optimizing recombinant Ssed_0302 expression in E. coli?

An effective experimental design for optimizing Ssed_0302 expression should utilize a multivariate approach rather than the traditional one-variable-at-a-time method. A statistical experimental design, particularly a fractional factorial screening design, allows for systematic evaluation of multiple variables simultaneously while accounting for their interactions.

For membrane proteins like Ssed_0302, eight key variables should be considered:

  • Induction absorbance (cell density at induction)

  • Inducer concentration (e.g., IPTG)

  • Expression temperature post-induction

  • Yeast extract concentration

  • Tryptone concentration

  • Glucose concentration

  • Glycerol concentration

  • Antibiotic (e.g., kanamycin) concentration

Based on statistical analysis from similar membrane protein expression studies, a 2^8-4 factorial design with center point replicates can be implemented. The following table shows significant effects observed in a similar membrane protein expression study:

VariableEffect on Cell Growth (p-value)Effect on Protein Activity (p-value)Effect on Process Productivity (p-value)
Induction absorbance1.43 (<0.0001)323.5 (0.0016)0.33 (0.2248)
IPTG-0.42 (0.0387)-52.0 (0.5422)-0.19 (0.4720)
Expression temperature1.13 (<0.0001)-340.8 (0.0011)-0.91 (0.0041)
Yeast extract0.86 (0.0004)77.0 (0.3706)0.23 (0.3930)
Tryptone0.67 (0.0027)268.2 (0.0061)0.79 (0.0095)
Glucose-0.33 (0.0920)164.3 (0.0685)0.37 (0.1797)
Glycerol-0.32 (0.1011)44.8 (0.5993)0.09 (0.7241)
Kanamycin0.31 (0.1163)256.0 (0.0082)0.72 (0.0160)

For Ssed_0302, optimized conditions might include induction at mid-exponential phase (OD600 ~0.8), lower IPTG concentration (0.1 mM), reduced temperature post-induction (25°C), and a medium composition of 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, with 1 g/L glucose. This approach has yielded high levels of soluble expression (250 mg/L) of similar functional membrane proteins .

  • How can researchers assess and improve the solubility of recombinant Ssed_0302 protein?

Improving the solubility of membrane proteins like Ssed_0302 requires a systematic approach addressing multiple factors:

  • Expression temperature modulation: Lower temperatures (15-25°C) slow protein synthesis, allowing more time for proper folding and reducing inclusion body formation. Statistical analysis shows expression temperature has a significant negative effect (-340.8, p=0.0011) on membrane protein activity despite positive effects on cell growth.

  • Detergent screening: A panel of detergents should be tested for extraction efficiency:

    • n-dodecyl-β-D-maltoside (DDM)

    • n-decyl-β-D-maltoside (DM)

    • Lauryldimethylamine-N-oxide (LDAO)

    • Detergent concentration should be maintained above the critical micelle concentration (CMC)

  • Fusion tag optimization: Various fusion partners can be employed:

    • Solubility-enhancing tags (SUMO, MBP, GST)

    • Affinity tags for purification (His, FLAG, Strep)

    • Stability tags (GFP, human fibronectin type III domain)

  • Co-expression with chaperones: Molecular chaperones like GroEL/GroES, DnaK/DnaJ/GrpE can assist with proper folding

  • Host strain selection: E. coli C41(DE3) and C43(DE3) strains were specifically developed for membrane protein overexpression. These strains contain mutations in the lac repressor gene and lacUV5 promoter that relieve toxicity caused by membrane protein overexpression .

  • Fluorescence-detection size exclusion chromatography (FSEC): When fused with GFP, this technique allows rapid assessment of protein folding and homogeneity without purification.

Monitoring solubility can be performed using the hemolytic activity assay for functional assessment or N-[4-(7-diethylamino-4-methyl-3-coumarinyl)phenyl] maleimide (CPM) assay for thermostability evaluation .

  • What are the most effective strategies for purifying recombinant Ssed_0302 for structural studies?

For structural studies of membrane proteins like Ssed_0302, a multi-step purification strategy is essential:

  • Initial extraction and solubilization:

    • Disrupt cells using mechanical methods (sonication, French press)

    • Solubilize membrane fraction with appropriate detergents (DDM is commonly used)

    • Maintain solubilization buffer conditions (pH 8.0, 150-300 mM NaCl)

  • Affinity chromatography:

    • For His-tagged Ssed_0302, use immobilized metal affinity chromatography (IMAC)

    • Employ gradient elution (20-500 mM imidazole)

    • Include detergent at concentrations above CMC in all buffers

  • Size exclusion chromatography:

    • Further purify protein-detergent complexes

    • Assess monodispersity (crucial for crystallization)

    • Can be coupled with dynamic light scattering (DLS) for quality assessment

  • Detergent exchange (if necessary):

    • Switch to detergents more suitable for crystallization

    • Consider lipid addition to stabilize protein

  • Concentration optimization:

    • Concentrate to 5-15 mg/mL for crystallization trials

    • Monitor aggregation during concentration

    • Use specialized membrane protein concentrators

  • Quality assessment:

    • SDS-PAGE (>85% purity is desirable)

    • Western blotting for identity confirmation

    • Thermal stability assays

    • Functional assays if applicable

For Ssed_0302, purification has been achieved to approximately 75% homogeneity in its active form when using optimized conditions .

  • What approaches can be used for structural determination of Ssed_0302?

Several complementary approaches can be employed for structural determination of membrane proteins like Ssed_0302:

  • X-ray crystallography:

    • Traditional vapor diffusion methods (hanging/sitting drop)

    • Lipidic cubic phase (LCP) crystallization, particularly effective for membrane proteins

    • Microseeding to improve crystal quality

    • Heavy atom (HA) derivatization for phase determination

    • Iodide single-wavelength anomalous diffraction (I-SAD) or multiple-wavelength anomalous dispersion (MAD)

  • Cryo-electron microscopy (cryo-EM):

    • Particularly useful for larger membrane protein complexes

    • Does not require crystallization

    • Advances in direct electron detectors have improved resolution

  • NMR spectroscopy:

    • Solution NMR for smaller membrane proteins or domains

    • Solid-state NMR for specific structural questions

  • Computational modeling:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to understand flexibility

    • Integration with experimental data for validation

For Ssed_0302, a combined approach starting with crystallographic trials in LCP with monoacylglycerol (MAGs) lipids, followed by computational modeling to fill structural gaps, might be most effective. If initial trials fail, consider protein engineering to remove flexible regions or fusion with crystallization chaperones .

  • How can the Experimental Design Ability Test (EDAT) framework be applied to Ssed_0302 research?

The Experimental Design Ability Test (EDAT) framework provides a structured approach for designing rigorous experiments with membrane proteins like Ssed_0302. The framework can be applied in the following manner:

  • Factor identification: Based on EDAT analysis, experiments should address both basic understanding (Factor 1) and advanced understanding (Factor 2) of experimental design. For Ssed_0302 research, this translates to:

    • Basic understanding elements (Factor 1):

      • Clear hypothesis formulation about Ssed_0302 function

      • Appropriate control selection (e.g., empty vector controls)

      • Basic variable identification (temperature, pH, salt concentration)

    • Advanced understanding elements (Factor 2):

      • Interrelatedness of experimental components

      • Alignment between hypothesis, methods, and data collection

      • Consideration of confounding variables in membrane protein studies

  • Experimental implementation:

    • Pre-test/post-test experimental design to evaluate changes

    • Use of comparison groups (e.g., different expression systems)

    • Blinded analysis of results to reduce bias

  • Assessment metrics:

    • Protein yield and purity (quantitative)

    • Functional activity assays (if function is known)

    • Structural integrity validation (CD spectroscopy, thermal shift)

This approach has demonstrated significantly higher gains in advanced experimental design understanding compared to traditional approaches. For example, in a study using EDAT framework, students in the experimental group demonstrated greater improvement on the composite EDAT scores from pre-test (M = 3.760, SE = 0.102) to post-test (M = 5.429, SE = 0.105) than comparison groups .

  • What tools can be used to assess the interrelatedness of experimental design when working with Ssed_0302?

The Tool for Interrelated Experimental Design (TIED) provides a comprehensive approach for ensuring internal consistency across experimental components when working with complex systems like membrane proteins:

  • Components of TIED assessment for Ssed_0302 research:

    ComponentKey CriteriaApplication to Ssed_0302
    Hypothesis formulationClear statement of predicted relationship"Ssed_0302 functions as a transporter based on its membrane localization and sequence features"
    Biological rationaleScientific justification based on prior knowledgeConnection to other characterized UPF0761 family members
    Experimental groupsProper control and treatment definitionsExpression with/without inducer; wild-type vs. mutant protein
    Data collectionMeasurements address all variables in hypothesisProtein expression levels, membrane localization, transport activity
    ObservationsData collection methods yield proposed observationsSpectroscopic methods can detect proposed conformational changes
  • Interrelatedness criteria specific to membrane proteins:

    • Alignment between solubilization method and downstream applications

    • Consistency between expression system and required post-translational modifications

    • Connection between purification approach and structural studies

    • Relationship between detergent selection and protein stability

  • Implementation strategy:

    • Use as both pre-assessment and post-assessment tool

    • Apply checklist format to evaluate each experimental plan

    • Score based on criteria satisfaction (all/partial/none)

    • Review for internal consistency across components

The TIED approach has demonstrated excellent interrater reliability (average ICC measure of 0.866) and is sensitive enough to detect growth in experimental design skills from beginning to end of research projects .

  • How can design science research methodology be applied to optimize Ssed_0302 expression and characterization?

Design science research methodology provides a powerful framework for optimizing the expression and characterization of challenging membrane proteins like Ssed_0302:

  • Problem identification and motivation:

    • Define specific challenges in Ssed_0302 expression (low yield, insolubility, instability)

    • Establish clear objectives for the optimization process

  • Iterative design cycles:

    • Conduct systematic modifications to expression and purification protocols

    • Each cycle involves design, implementation, evaluation, and reflection

    • Document all changes and outcomes systematically

  • Artifact development:

    • The "artifact" is the optimized protocol for Ssed_0302 expression

    • Multiple artifacts may be developed for different research applications (structural studies vs. functional analysis)

  • Evaluation metrics:

    • Quantitative: yield, purity, stability measurements

    • Qualitative: ease of implementation, reproducibility, transferability

  • Reflection and learning:

    • Analyze successful and unsuccessful approaches

    • Generate knowledge about both the specific protein and the methodology

  • Communication of results:

    • Document the design process, not just the final protocol

    • Include failed approaches and their analysis

This methodology has been successfully applied in engineering education research contexts and can be equally valuable for complex scientific protocol optimization, particularly for challenging membrane proteins where systematic approaches are essential .

  • What are the key considerations for designing a functional assay for Ssed_0302?

Designing a functional assay for a membrane protein with unknown function like Ssed_0302 requires a systematic approach:

  • Function prediction based on bioinformatic analysis:

    • Sequence homology with characterized proteins

    • Presence of conserved domains or motifs

    • Structural prediction and comparison to known functional elements

    • Genomic context analysis (operons, gene clusters)

  • Assay development considerations:

    • Transport activity: If predicted to be a transporter:

      • Liposome reconstitution with fluorescent substrate analogs

      • Membrane potential-sensitive dyes

      • Radioactive substrate uptake measurements

    • Enzymatic activity: If predicted to have catalytic function:

      • Substrate screening based on related proteins

      • Coupled enzyme assays for detecting products

      • Detection of cofactor consumption/production

    • Binding assays: If predicted to bind specific molecules:

      • Surface plasmon resonance (SPR)

      • Isothermal titration calorimetry (ITC)

      • Fluorescence-based binding assays

  • Controls and validation:

    • Inactive mutants (e.g., site-directed mutagenesis of predicted functional residues)

    • Competition with known ligands of related proteins

    • Dose-response relationships to validate specificity

  • Physiological relevance:

    • Correlation with the natural environment of S. sediminis

    • Consideration of temperature (psychrophilic nature)

    • Salt requirements (Na+-requiring)

  • Scalability and throughput:

    • Adaptation to microplate format for screening

    • Automation potential for systematic testing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.