Recombinant Shewanella sp. Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Introduction

Shewanella species are known for their diverse respiratory capabilities, particularly their ability to use extracellular respiration by employing enzymatic machinery outside the cell . Fumarate reductase is a key enzyme induced under anaerobic growth conditions in bacteria . Recombinant Shewanella sp. Fumarate reductase subunit D (frdD) is a component of the fumarate reductase complex in Shewanella species . Fumarate reductase (QFR) facilitates the last step in microbial anaerobic respiration .

Function and Structure

Fumarate reductase (quinol) (EC 1.3.5.4), also known as quinol:fumarate reductase, catalyzes the following reaction :
$$ \text{fumarate + quinol} \longrightarrow \text{succinate + quinone} $$
The fumarate reductase complex includes four subunits . Subunit A contains the fumarate reduction site and a covalently bound flavin adenine dinucleotide (FAD) prosthetic group. Subunit B is closely bound to subunit A and contains three iron-sulfur centers near the substrates. Subunit C consists of hydrophobic membrane-spanning segments and is the site of quinol oxidation; it may also bind one or more heme groups that participate in electron transfer. Subunit D (frdD) contains hydrophobic alpha helices that span the membrane and anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones .

Significance in Anaerobic Respiration

Fumarate reductase is essential for anaerobic respiration, especially when oxygen levels are low . The enzyme oxidizes quinol and transfers the released electrons to fumarate, reducing it to succinate. This process is crucial for energy production in anaerobic conditions .

Role in Shewanella Species

Shewanella species, such as Shewanella oneidensis MR-1, utilize fumarate reductase for anaerobic respiration . These bacteria can respire various substrates, including dimethyl sulfoxide (DMSO) and bromate, using extracellular enzymes . Studies have identified gene clusters required for anaerobic respiration of DMSO in S. oneidensis, with DMSO reductase subunits localized on the outer leaflet of the outer membrane .

Fumarate Reductase Mechanism

The reduction of fumarate is achieved through the oxidation of a quinol bound to subunit C, with electrons transferred down a chain of iron-sulfur clusters to a FAD molecule . The edge-to-edge distances between the quinol, iron-sulfur clusters, and FAD do not exceed 12.5 Angstroms, facilitating efficient electron transfer. The FAD molecule, bound to the catalytic site, reduces fumarate via a hydride attack on the double bond .

Relationship to Succinate Dehydrogenase

Succinate dehydrogenase (SQR) is a key enzyme in the citric acid cycle and the electron transport chain, performing the reverse reaction of QFR . Both SQR and QFR are related, with similar structures and a common subunit arrangement. They exhibit functional overlap and redundancy in various organisms, and can substitute each other under certain conditions .

Bromate Reduction

Shewanella oneidensis MR-1 can effectively reduce bromate under microaerobic conditions, a process mediated by the extracellular terminal reductase DmsA . This reduction process also requires membrane-anchored CymA and the type II protein secretion system. Sequence alignment has identified homologs to DmsA, GspD, and CymA in several Shewanella species, suggesting their potential roles in biogeochemical cycling of bromine .

Research Findings

  • Crystal Structures: The crystal structures of soluble fumarate reductase from Shewanella putrefaciens MR-1 have been solved, revealing a flexible capping domain linked to the FAD-binding domain . These structures provide insights into the catalytic mechanism of fumarate reduction .

  • Bifunctional Enzyme: In Geobacter sulfurreducens, the FrdCAB operon encodes a bifunctional enzyme that acts as both fumarate reductase and succinate dehydrogenase . Mutagenesis studies have shown that the frdA-deficient strain does not grow with fumarate as an electron acceptor .

  • Flavinylation: Flavinylation of Ser48 in FrdA is essential for fumarate reductase activity in Listeria monocytogenes, mediating electron transfer to the FAD cofactor at the active site .

  • Extracellular Reductases: Extracellular reductases in Shewanella possess a post-translationally flavinylated sequence motif, enabling extracellular electron transfer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
frdD; Sputw3181_0201; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Shewanella sp. (strain W3-18-1)
Target Names
frdD
Target Protein Sequence
MINYSPKRSDEPIWWGLFGAGGVWFAMITPVTVLLMGILLPLHGFGVVDIGYDKVYAFVS HPIGGAFTVLSLSLPMWHAMHRVHHGLHDLQIHLGTVGKYACYLAAALVTVLATVWVIQL S
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of fumarate reductase in Shewanella species?

Fumarate reductase catalyzes the terminal step in fumarate respiration, one of the most widespread types of anaerobic respiration found in bacteria. In Shewanella species, particularly S. putrefaciens MR-1, the enzyme exists as a soluble periplasmic tetraheme flavocytochrome c that catalyzes the reduction of fumarate to succinate during anaerobic metabolism . This enzyme plays a critical role in the electron transport chain under oxygen-limited conditions, serving as a terminal electron acceptor complex. The crystal structures of this enzyme reveal a sophisticated architecture with a flexible capping domain linked to the FAD-binding domain, allowing efficient electron transfer . Importantly, all redox centers in the flavocytochrome c fumarate reductase maintain van der Waals contact with one another, creating an efficient conduit for electrons to flow from the hemes via FAD to fumarate . This arrangement highlights the evolutionary adaptation of Shewanella for optimized electron transfer during anaerobic respiration.

What are the structural features of Shewanella fumarate reductase?

The fumarate reductase of Shewanella putrefaciens MR-1 has been crystallographically characterized at multiple resolutions: 2.9 Å for the uncomplexed form, 2.8 Å for the fumarate-bound protein, and 2.5 Å for the succinate-bound protein . These structures reveal several key features:

  • The enzyme exists as a periplasmic tetraheme flavocytochrome c, indicating it contains both heme groups and FAD as cofactors

  • A flexible capping domain is linked to the FAD-binding domain, likely playing a role in substrate binding or product release

  • All redox centers maintain van der Waals contact with one another, creating an efficient electron transfer pathway

  • The enzyme exhibits a unique soluble periplasmic nature, unlike the membrane-bound fumarate reductases found in many other bacteria

This structural arrangement facilitates efficient electron transfer from the hemes via FAD to fumarate, enabling effective fumarate respiration under anaerobic conditions. The mechanism for the reverse reaction serves as a model for the homologous succinate dehydrogenase (complex II) of the respiratory chain . The soluble nature of Shewanella's fumarate reductase represents an interesting evolutionary adaptation compared to the membrane-bound complexes typically found in other bacterial species.

What challenges exist in expressing recombinant Shewanella sp. frdD?

Expressing recombinant Shewanella sp. frdD presents several significant challenges that researchers must address through careful experimental design. If frdD functions as a membrane anchor subunit, expression in heterologous systems may result in protein misfolding, aggregation, or incorrect membrane insertion. Membrane protein expression generally requires specialized vectors, host strains, and careful optimization of expression conditions. The potential presence of multiple transmembrane domains in frdD would necessitate the use of detergents, lipid nanodiscs, or other membrane mimetics during purification and characterization to maintain proper folding and function. Additionally, if frdD contains cofactors such as heme groups (suggested by the tetraheme nature of the complex), proper incorporation of these cofactors in heterologous expression systems may be problematic . Expression in E. coli strains specifically engineered for membrane protein production (such as C41/C43) might improve yields, while co-expression with chaperones could enhance proper folding. Furthermore, frdD may have co-evolved with other subunits of the fumarate reductase complex, potentially requiring co-expression with these partners for stability and proper function.

What role do extracellular electron transport genes play in Shewanella metabolism?

Extracellular electron transport (EET) genes play a fundamental role in Shewanella's remarkable respiratory versatility. Research has identified a strong correlation between the ability of Shewanella strains to accumulate on mineral surfaces and the presence of key EET genes such as mtrBC/omcA (SO_1778, SO_1776, and SO_1779) . These genes encode outer membrane cytochromes that facilitate electron transfer to external electron acceptors. Additionally, genes coding for methyl-accepting chemotaxis proteins (MCPs) with Ca²⁺ channel chemotaxis receptor (Cache) domains (such as SO_2240) are essential for the characteristic run-and-reversal swimming behavior around insoluble electron acceptor surfaces . The EET pathway in Shewanella begins with electron donors like lactate, which reduce quinones while simultaneously transferring protons into the periplasm, building proton motive force (pmf) . In the absence of soluble electron acceptors, electrons flow through CymA to the MtrCAB outer membrane complex, which can donate electrons directly to terminal electron acceptors or via flavin molecules . This sophisticated electron transport system allows Shewanella to utilize a diverse range of electron acceptors, including insoluble minerals, contributing to their ecological success in various anaerobic environments.

How can protein-protein interactions between frdD and other fumarate reductase subunits be studied?

Investigating protein-protein interactions between frdD and other fumarate reductase subunits requires a multi-technique approach that captures both structural and functional aspects of these associations. Researchers can employ crosslinking mass spectrometry (XL-MS) to identify interaction interfaces by covalently linking amino acids in close proximity, followed by proteolytic digestion and MS analysis to map the crosslinked residues. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides complementary information by revealing regions protected from solvent exchange upon complex formation. For real-time interaction kinetics, surface plasmon resonance (SPR) or biolayer interferometry (BLI) can measure association and dissociation rates between purified frdD and other subunits under various conditions. In vivo interactions can be investigated using bacterial two-hybrid systems, where interaction between bait and prey proteins reconstitutes a functional transcriptional activator or reporter system. Advanced structural techniques like cryo-electron microscopy (cryo-EM) are particularly valuable for membrane protein complexes like fumarate reductase, potentially providing high-resolution structures of the intact complex. Additionally, computational approaches such as molecular docking and molecular dynamics simulations can predict interaction interfaces and the effects of mutations on complex stability.

What expression systems are optimal for producing recombinant Shewanella sp. frdD?

The optimal expression system for producing recombinant Shewanella sp. frdD depends on research objectives and downstream applications. For preliminary characterization, E. coli BL21(DE3) derivatives specialized for membrane protein expression (C41/C43 strains) offer a good starting point, as they can tolerate the toxic effects often associated with membrane protein overexpression. These systems can be enhanced with tight expression control using pET vectors with T7lac promoters or the tuneable Lemo21(DE3) system. For more challenging expression scenarios, consider Shewanella's codon usage when designing expression constructs, as codon optimization can significantly improve yields in heterologous hosts. If E. coli systems prove inadequate, eukaryotic systems like Pichia pastoris may provide advantages for complex membrane proteins, offering proper membrane insertion and post-translational modifications. For in vitro studies requiring rapid screening of conditions, cell-free expression systems supplemented with nanodiscs, liposomes, or detergent micelles may facilitate direct incorporation of frdD into membrane-mimetic environments. When selecting purification strategies, consider using mild detergents (DDM, LMNG) that maintain membrane protein structure while solubilizing the target protein. The addition of stabilizing ligands or binding partners during expression and purification can enhance yield and stability. Where possible, co-expression with other fumarate reductase subunits may improve folding and stability by allowing native-like interactions to form during translation.

How can site-directed mutagenesis be used to study frdD function?

Site-directed mutagenesis provides a powerful approach for dissecting structure-function relationships in frdD by systematically altering specific amino acids and measuring the functional consequences. Begin by identifying conserved residues through multiple sequence alignment of frdD across Shewanella species and related bacteria. Target residues predicted to be involved in critical functions such as heme binding (typically histidines), quinone interaction sites (often aromatic residues), subunit interfaces, or membrane anchoring domains. Implement a systematic mutagenesis strategy, including conservative substitutions (maintaining similar physicochemical properties), non-conservative changes, and alanine-scanning (replacing residues with alanine to eliminate side chain contributions while maintaining backbone structure). For membrane-spanning regions, consider substitutions that alter hydrophobicity or helix-packing properties. When designing functional assays for mutants, measure multiple parameters including: complex assembly efficiency, membrane insertion capabilities, fumarate reduction activity, electron transfer rates, and thermal stability. Incorporate structural characterization using circular dichroism to assess secondary structure changes, thermal shift assays to evaluate stability alterations, and where possible, crystallography or cryo-EM to visualize structural impacts. For testing physiological relevance, complement Shewanella strains lacking native frdD with mutant variants and assess growth under anaerobic conditions with fumarate as the sole electron acceptor.

What techniques can assess the functionality of recombinant frdD?

Assessing the functionality of recombinant frdD requires a multi-faceted approach that evaluates both structural integrity and functional capabilities. For isolated frdD, begin with structural validation using circular dichroism (CD) spectroscopy to confirm secondary structure elements and thermal shift assays to assess protein stability. If frdD contains heme cofactors, UV-visible spectroscopy and electron paramagnetic resonance (EPR) can characterize the redox properties and coordination environment of these centers. For membrane insertion assessment, reconstitute purified frdD into liposomes or nanodiscs and evaluate proper incorporation using protease protection assays or fluorescence-based techniques. To assess functional integration with other fumarate reductase subunits, perform co-purification experiments or measure complex formation using analytical size exclusion chromatography or native PAGE. The ultimate functional test involves reconstituting the complete fumarate reductase complex containing recombinant frdD and measuring enzymatic activity. For fumarate reductase, this typically involves monitoring fumarate reduction spectrophotometrically using artificial electron donors or coupling the reaction to quinol oxidation. Additionally, electrochemical techniques like protein film voltammetry can directly measure electron transfer capabilities of the reconstituted complex. For in vivo functional assessment, complement a Shewanella strain lacking native frdD with the recombinant version and measure growth under anaerobic conditions with fumarate as the terminal electron acceptor.

How does the chemotaxis signal transduction pathway integrate with fumarate reduction?

The chemotaxis signal transduction pathway in Shewanella integrates closely with fumarate reduction through a sophisticated sensory mechanism that coordinates cell movement with electron acceptor availability. According to Figure 1B in the research literature, Shewanella employs methyl-accepting chemotaxis proteins (MCPs) that control flagella rotation via the chemotaxis signal transduction system . These chemoreceptors likely detect changes in the proton concentration during metal reduction, effectively serving as "self-sensing" mechanisms for monitoring electron transport activity . When an MCP is stimulated, its structure shifts like a piston, causing the autophosphorylation of CheA to slow or stop, which prevents the phosphorylation of CheY and CheB . Without CheY-P, the flagellar motor promotes smooth swimming rather than tumbling, allowing directional movement. This stimulation also affects methylation states through CheR (methyltransferase) and CheB (methylesterase) activities, creating a feedback loop that modulates swimming patterns . This system enables the characteristic "run-and-reversal" swimming behavior observed when Shewanella cells encounter insoluble electron acceptors, facilitating accumulation around preferred electron acceptors like Fe(OH)₃ or MnO₂ . The specific preference for certain electron acceptors varies between Shewanella species, reflecting their evolutionary adaptation to different environmental niches.

How do different Shewanella species vary in their virulence and antimicrobial resistance profiles?

Shewanella species exhibit substantial variation in their virulence factors and antimicrobial resistance profiles, reflecting their diverse ecological niches and evolutionary history. Recent genomic analyses have identified 56 potential virulence genes across Shewanella species, encompassing 19 distinct virulence factors . Different species possess characteristic virulence gene patterns: S. algae commonly carries genes related to the Type VI secretion system (T6SS), including the hcp gene (inner tube component) and vgrG (effector protein), suggesting T6SS may be a primary virulence mechanism for this species . In contrast, S. indica lacks T6SS-related genes but typically possesses flagellar genes, while S. chilikensis also predominantly harbors flagella-related virulence genes . Most Shewanella strains carry potential virulence genes related to flagella and chemotactic proteins, facilitating motility and substrate sensing, but rarely possess genes associated with Type III and Type I secretion systems .

Antimicrobial resistance presents another dimension of variation. Clinical Shewanella isolates show concerning resistance patterns, with high resistance rates to polymyxin E (76.92%), cefotaxime (57.69%), and ampicillin (50%) . Multidrug resistance appears in 38.46% of clinical isolates, with resistance profiles spanning β-lactams, quinolones, and polymyxins . Genomic analysis identified nine antimicrobial resistance genes across isolates, with individual strains carrying various combinations . Interestingly, phenotypic polymyxin resistance appears without identifiable resistance determinants, suggesting novel resistance mechanisms involving outer membrane modifications, efflux pumps, or capsular polysaccharides . These diverse virulence and resistance profiles have significant implications for research focused on recombinant frdD expression and fumarate reductase characterization, potentially affecting strain selection and biosafety considerations.

What novel experimental approaches are being developed to study bacterial electron transport systems?

Advanced experimental approaches for studying bacterial electron transport systems like fumarate reductase are evolving rapidly, providing unprecedented insights into these complex processes. One innovative approach is the cell accumulation after photo-bleaching (CAAP) confocal microscopy technique, which allows quantitative assessment of bacterial congregation and attachment to insoluble electron acceptors . This method uses UV laser irradiation to quench the fluorescence of GFP-labeled cells around a given electron acceptor, then measures the rate at which new fluorescent cells accumulate and attach to the substrate . Combined with specialized cell-tracking techniques, CAAP has revealed species-specific preferences for electron acceptors and the genetic basis for these behaviors.

Another frontier involves real-time visualization of electron transfer using fluorescent redox sensors or electrochemical imaging techniques. Researchers are developing microfluidic platforms that integrate electrodes, allowing simultaneous electrical measurements and optical imaging of bacterial interactions with electron acceptors. Cryo-electron tomography is advancing our ability to visualize intact electron transport complexes within their native membrane environment at sub-nanometer resolution. Complementary to these structural approaches, high-throughput genetic methods like random barcoded transposon sequencing (RB-TnSeq) are identifying previously unknown components of electron transport pathways.

For recombinant studies, cell-free protein synthesis systems incorporating nanodiscs or liposomes allow direct expression of membrane proteins like frdD into membrane-mimetic environments, circumventing challenges associated with cellular expression. Finally, computational approaches integrating molecular dynamics simulations with quantum mechanical calculations are providing theoretical frameworks for understanding electron transfer mechanisms at atomic resolution, guiding experimental design and interpretation.

How might recombinant fumarate reductase components contribute to bioelectrochemical applications?

Recombinant fumarate reductase components from Shewanella, including frdD, hold significant potential for bioelectrochemical applications due to their role in extracellular electron transfer. Shewanella's natural capacity for bidirectional electron exchange with solid surfaces makes its electron transport components particularly valuable for bioelectrochemical systems. Recombinant fumarate reductase subunits could be engineered for enhanced stability, activity, or substrate specificity, potentially improving the performance of microbial fuel cells, biosensors, or biocatalytic systems. By understanding the structure-function relationships in components like frdD, researchers could design optimized electron conduits between electrodes and enzymatic systems.

The research on Shewanella's congregation behavior around insoluble electron acceptors provides insights for bioelectrochemical interface design . The demonstrated ability of specific Shewanella strains to recognize and attach to different metal oxides could inform electrode material selection and surface modifications to enhance bacterial attachment and electron transfer efficiency . Furthermore, understanding the genetic basis for electron acceptor preferences could enable the engineering of strains with enhanced affinity for specific electrode materials.

Recombinant expression of frdD and other fumarate reductase components could facilitate the development of cell-free bioelectrochemical systems, where purified proteins rather than whole organisms mediate electron transfer. Such systems might offer advantages in terms of stability, reproducibility, and reduced complexity compared to whole-cell approaches. Additionally, the incorporation of fumarate reductase components into artificial membrane systems or conductive polymers could create hybrid biological-electronic interfaces with applications in biosensing, biocomputing, or bioelectrosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.