Recombinant Shewanella sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Properties and Catalytic Mechanism

PlsY belongs to the glycerol-3-phosphate acyltransferase (GPAT) family, which transfers acyl groups from acyl-CoA or acyl-acyl carrier protein (acyl-ACP) to glycerol-3-phosphate (G3P). Key findings include:

  • Mechanism:

    • The HXXXXD motif facilitates deprotonation of G3P’s sn-1 hydroxyl group, enabling nucleophilic attack on the acyl donor .

    • Motif III enhances substrate binding affinity, particularly for G3P .

  • Activity Profile:

    • Optimal activity occurs at neutral to slightly alkaline pH, consistent with its role in cytoplasmic lipid biosynthesis .

    • Mutations in motif III (e.g., T180S in human AGPAT1 homologs) reduce substrate affinity without affecting acyl-CoA binding .

Recombinant Expression Systems

PlsY variants have been produced using E. coli expression systems, enabling high-yield purification for biochemical studies . Notable advancements in Shewanella genetic engineering, such as phage-derived recombineering systems (e.g., W3 Beta recombinase), support precise genome editing for optimizing recombinant protein production .

Research Findings and Functional Insights

  • Evolutionary Conservation:
    PlsY’s catalytic motifs (HXXXXD, motif III) are evolutionarily conserved across bacterial GPATs, highlighting their essential role in lipid biosynthesis .

  • Substrate Specificity:
    While Shewanella PlsY primarily utilizes acyl-ACP donors, homologs in other bacteria (e.g., E. coli) show flexibility toward acyl-CoA substrates .

  • Localization and Regulation:
    Studies on related Shewanella enzymes (e.g., shewasin proteases) suggest cytoplasmic localization for PlsY, contrasting with membrane-associated eukaryotic GPATs .

Table 1: Recombinant PlsY Variants from Shewanella sp.

Catalog NumberUniProt IDAmino Acid RangeStrain Source
RFL36349SFA1RMH71–203Shewanella sp. MR-4
RFL20314SFQ0HG431–203Shewanella sp. MR-4
RFL14841SFQ0HSD61–203Shewanella sp. MR-4

Table 2: Key Enzymatic Features of Bacterial GPATs

FeaturePlsY (Shewanella)GPAT (E. coli)
Catalytic MotifsHXXXXD, III, IVHXXXXD, III, IV
Substrate PreferenceAcyl-ACPAcyl-ACP/CoA
pH OptimumNeutral (7.0–8.0)Neutral (7.0–8.0)

Applications in Biotechnology

Recombinant PlsY serves as a model enzyme for:

  • Lipid Engineering: Modifying bacterial membranes to enhance stress tolerance or optimize lipid production .

  • Drug Discovery: Targeting bacterial phospholipid biosynthesis pathways for antibiotic development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your specified tag.
Synonyms
plsY; Shewana3_3082; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Shewanella sp. (strain ANA-3)
Target Names
plsY
Target Protein Sequence
MSQLTLTLLMIVAAYLAGSVSSAVLVCRMRGLPDPRLQGSGNPGATNVLRIGGASSAAMV LFFDMLKGALPTYLAYLMGIDAISLGLIAIAACLGHIYPIFFGFKGGKGVATAFGAMAPI GDDLAICLMASWVVLVLISRYSSLAAIITALLAPLYTWWLDDRFTIPVAMLSTLIIIRHK ENIQRLLKGEESKVSRKKRPKAP
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does plsY differ from plsC in the phospholipid biosynthesis pathway of Shewanella?

While both plsY and plsC participate in phospholipid biosynthesis, they catalyze sequential and distinct reactions:

  • plsY (Glycerol-3-phosphate acyltransferase): Catalyzes the first acylation step, transferring an acyl group to the sn-1 position of glycerol-3-phosphate to form lysophosphatidic acid (LPA).

  • plsC (1-acyl-sn-glycerol-3-phosphate acyltransferase): Catalyzes the second acylation step, transferring an acyl group to the sn-2 position of LPA to form phosphatidic acid (PA) .

The substrate preferences and specificities of these enzymes differ significantly. Studies with Shewanella livingstonensis Ac10 demonstrated that plsC1 shows preference for eicosapentaenoic acid (EPA)-containing substrates, which influences membrane composition at low temperatures . The plsC1 knockout mutant strain (ΔplsC1) exhibited decreased EPA-containing phospholipids and became filamentous at 4°C, similar to EPA-deficient strains .

Interestingly, expression of E. coli PlsC in the ΔplsC1 mutant restored EPA-containing phospholipids but did not correct the filamentous phenotype, suggesting species-specific functions beyond catalytic activity, possibly related to protein-protein interactions or subcellular localization .

What expression systems are most effective for producing recombinant Shewanella plsY?

Based on successful protein expression systems developed for Shewanella species, researchers can consider several approaches for recombinant plsY production:

Homologous Expression Systems:

  • A robust electroporation method for Shewanella oneidensis with efficiency reaching ~4.0 × 10^6 transformants/μg DNA provides an excellent foundation for homologous expression .

  • This approach maintains the native cellular environment, which is particularly important for membrane-associated proteins like plsY.

Heterologous Expression in E. coli:

  • While E. coli systems offer high yields, careful optimization is required, particularly regarding membrane association.

  • Fusion tags (MBP, SUMO) can improve solubility while maintaining protein structure.

  • Co-expression with chaperones may enhance proper folding.

Genome Editing Approaches:

  • The λ Red recombineering system adapted from Shewanella sp. W3-18-1 offers precise genome editing with ~5% recombination efficiency .

  • This approach allows for chromosomal integration of expression constructs with native or modified regulatory elements.

Expression Vector Considerations:

  • Low-copy vectors with tightly controlled inducible promoters can minimize toxicity.

  • Inclusion of a periplasmic signal sequence may facilitate proper membrane targeting.

The choice of expression system should be guided by research objectives, required protein yield, and the importance of post-translational modifications or membrane association for enzyme activity.

How should experimental design be structured to characterize temperature and pH dependence of Shewanella plsY activity?

A rigorous experimental design for characterizing the temperature and pH dependence of Shewanella plsY should include the following components:

Temperature Dependence Study:

  • Hypothesis: "Shewanella plsY exhibits optimal activity at temperatures reflecting the ecological niche of the source organism."

  • Independent Variable: Temperature range (0-45°C in 5°C increments)

  • Dependent Variable: Enzyme activity (μmol product formed per minute per mg protein)

  • Controls:

    • Negative control: Heat-inactivated enzyme preparation

    • Positive control: Well-characterized related enzyme (e.g., E. coli plsY)

  • Fixed Variables: pH, substrate concentrations, buffer composition, enzyme concentration3

pH Dependence Study:

  • Hypothesis: "Shewanella plsY exhibits optimal activity at a specific pH that reflects intracellular conditions of Shewanella species."

  • Independent Variable: pH range (5.0-9.0 in 0.5 pH increments)

  • Dependent Variable: Enzyme activity

  • Controls:

    • Buffer-only controls to account for buffer effects

    • Overlapping buffer systems to control for buffer-specific effects

  • Fixed Variables: Temperature, substrate concentrations, ionic strength, enzyme concentration3

Data Analysis:

  • Collect measurements in triplicate for statistical validation

  • Use non-linear regression to determine optimal conditions

  • Calculate activation energy (Ea) from Arrhenius plots for temperature studies

  • Determine pKa values of catalytic residues from pH profiles

Presentation of Results:

  • Activity profiles (% relative activity vs. temperature or pH)

  • Comparison with similar enzymes from mesophilic and psychrophilic organisms

  • Statistical analysis of significance in activity differences

This experimental design ensures comprehensive characterization of enzyme parameters while controlling for variables that could confound interpretation of results.

What are the appropriate methods for analyzing the kinetic parameters of recombinant Shewanella plsY?

Comprehensive kinetic analysis of recombinant Shewanella plsY requires systematic approaches to determine substrate affinities, catalytic rates, and reaction mechanisms. The following methodological framework is recommended:

Table 1: Methodological Approaches for Kinetic Parameter Determination

ParameterMethodExperimental ConditionsData Analysis
Km and VmaxInitial velocity measurementsVarying substrate concentrations (0.2-5× Km) with fixed enzymeNon-linear regression to Michaelis-Menten equation
Reaction mechanismBi-substrate kineticsMatrix of substrate concentrations for both G3P and acyl donorGlobal fitting to ping-pong or sequential mechanisms
kcatTurnover number calculationFixed saturating substrate with known enzyme concentrationVmax/[Enzyme]
Inhibition constantsInhibitor studiesVarying substrate with fixed inhibitor concentrationsDixon or Cornish-Bowden plots
Temperature effectsActivity at different temperaturesStandard assay at 5-45°C rangeArrhenius plots for activation energy
pH effectsActivity at different pHStandard assay at pH 5.0-9.0 rangeDetermination of optimal pH and pKa values

Assay Methodology:

  • Spectrophotometric detection of free CoA (DTNB method) for acyl-CoA substrates

  • Radiolabeled substrate incorporation for highest sensitivity

  • LC-MS analysis of reaction products for comprehensive characterization

  • Coupled enzyme assays for continuous monitoring

Critical Controls:

  • No-enzyme control to account for non-enzymatic reactions

  • Heat-inactivated enzyme control

  • Linearity validation with varying enzyme concentration

  • Time course analysis to ensure initial velocity conditions

  • Replicate measurements (minimum triplicate) for statistical validation3

Data Presentation:

  • Direct plots of velocity versus substrate concentration

  • Secondary plots (Lineweaver-Burk, Eadie-Hofstee) for mechanism elucidation

  • Statistical analysis of parameter uncertainty (standard errors, confidence intervals)

This comprehensive approach enables detailed characterization of enzyme kinetics, providing insights into the catalytic mechanisms and evolutionary adaptations of Shewanella plsY.

How can site-directed mutagenesis be effectively used to investigate the catalytic mechanism of Shewanella plsY?

Site-directed mutagenesis represents a powerful approach to elucidate the catalytic mechanism and structure-function relationships of Shewanella plsY. The recently developed λ Red recombineering system from Shewanella sp. W3-18-1, with an efficiency of ~5% recombinants among total cells, provides an excellent platform for genetic manipulation .

Strategic Approach to Mutational Analysis:

  • Identification of Target Residues:

    • Highly conserved residues from multiple sequence alignments of bacterial plsY homologs

    • Predicted active site residues from homology modeling or structural predictions

    • Residues implicated in substrate binding from docking studies

    • Residues at the membrane interface that may regulate substrate access

  • Types of Mutations to Consider:

    • Conservative substitutions (e.g., Asp→Glu) to test specific chemical properties

    • Non-conservative substitutions (e.g., His→Ala) to completely eliminate functional groups

    • Introduction of steric bulk (e.g., Ala→Trp) to probe spatial requirements

    • Charge reversals (e.g., Lys→Glu) to test electrostatic interactions

  • Systematic Mutational Series:

    • Alanine scanning of putative active site region

    • Cysteine scanning for accessibility studies using thiol-reactive probes

    • Progressive truncations of flexible regions

Functional Characterization of Mutants:

Table 2: Analytical Methods for Mutant Characterization

AnalysisTechniqueInformation GainedInterpretation
Catalytic activityStandard enzyme assaysChanges in kcat, KmRole in catalysis or substrate binding
Substrate specificityActivity with various acyl donorsAltered substrate preference profilesSubstrate recognition determinants
Protein stabilityThermal shift assays, CD spectroscopyTm changes, secondary structure alterationsContribution to structural integrity
Membrane associationMembrane fractionation, fluorescence microscopyLocalization patternsImportance for proper cellular context
Substrate bindingIsothermal titration calorimetryBinding constants, thermodynamic parametersDirect substrate interactions

Integrated Analysis Framework:

  • Correlation of structural position with functional impact

  • Identification of catalytic triads or dyads

  • Mapping of substrate binding pockets

  • Elucidation of rate-limiting steps in catalysis

By systematically altering specific residues and characterizing the resulting effects on enzyme function, researchers can construct a detailed model of the catalytic mechanism of Shewanella plsY and identify species-specific adaptations that might relate to environmental niches.

What approaches can resolve contradictory data when characterizing recombinant Shewanella plsY?

When faced with contradictory data in the characterization of recombinant Shewanella plsY, researchers should implement a systematic troubleshooting and resolution framework. Conflicting results may arise from variations in expression systems, purification methods, assay conditions, or intrinsic properties of the enzyme.

Systematic Resolution Approach:

  • Methodological Standardization:

    • Implement consistent protocols across experiments and laboratories

    • Document all experimental parameters in detail, including buffer compositions, pH, temperature, and reaction times

    • Use internal standards and controls in all assays

  • Cross-Validation Strategies:

    • Apply multiple orthogonal techniques to measure the same parameter

    • For example, validate activity measurements using both spectrophotometric and chromatographic methods

    • Compare results from different expression systems (homologous vs. heterologous)

  • Parameter Space Exploration:

    • Systematically vary experimental conditions to identify sensitivity to specific parameters

    • Create contour plots of activity across temperature-pH space to identify optimal conditions

    • Test multiple buffer systems to detect buffer-specific effects

Common Sources of Contradictions and Resolution Strategies:

Table 3: Addressing Contradictory Data in Enzyme Characterization

Contradiction TypePotential CausesResolution StrategiesValidation Approach
Activity discrepanciesVariation in enzyme preparation, Assay interferenceStandardize purification protocol, Test for inhibitors in buffersCompare specific activity across multiple purification batches
Substrate specificity differencesAssay sensitivity limits, Competitive inhibitionUse multiple detection methods with different sensitivity ranges, Perform competition studiesCross-validate with isothermal titration calorimetry
Kinetic parameter inconsistenciesData fitting approach differences, Non-steady state measurementsApply multiple fitting models, Ensure initial velocity conditionsStatistical comparison of parameter confidence intervals
Temperature optima variationsBuffer pH temperature dependence, Protein stability differencesUse temperature-independent buffers, Monitor protein stability during assaysTime-course stability studies at each temperature
Expression system discrepanciesPost-translational modifications, Membrane environment differencesCompare homologous and heterologous expression, Test activity in various membrane mimeticsStructural characterization of protein from each system
  • Integrated Data Analysis:

    • Apply statistical methods to determine significance of discrepancies

    • Use Bayesian approaches to integrate conflicting datasets

    • Consider global fitting of multiple datasets with shared parameters

  • Biological Context Consideration:

    • Evaluate if contradictions reflect genuine biological variability

    • Consider strain-specific or niche-specific adaptations

    • Examine whether different Shewanella species show systematic differences in enzyme properties

By implementing this systematic approach, researchers can resolve contradictions and develop a more nuanced understanding of the true properties and functional characteristics of recombinant Shewanella plsY.

What are the optimal conditions for assaying recombinant Shewanella plsY activity?

The optimal conditions for assaying recombinant Shewanella plsY activity should be systematically determined and may vary depending on the specific Shewanella species, as different species have adapted to diverse ecological niches ranging from deep-sea environments to Antarctic waters . The following parameters provide a starting framework for optimization:

Buffer and pH:

  • A range of buffers including HEPES, PIPES, and Tris (50-100 mM) should be tested

  • Initial pH screening from 6.0-8.5, with finer optimization around identified optima

  • Buffer pH should be adjusted to account for temperature effects (approximately -0.017 pH units/°C for Tris buffers)

Temperature:

  • For cold-adapted Shewanella species, test a range from 0-30°C in 5°C increments

  • For mesophilic species, test from 15-45°C

  • Compare temperature profiles with growth temperature optima of source organisms3

Ionic Strength and Cations:

  • NaCl concentration typically 50-150 mM, reflecting marine environment of many Shewanella species

  • Essential divalent cations (Mg²⁺, Mn²⁺) at 1-10 mM as potential cofactors

  • EDTA (0.1-1 mM) to chelate inhibitory heavy metals, unless divalent metals are required for activity

Substrate Concentrations:

  • Glycerol-3-phosphate: typically 0.1-2 mM

  • Acyl donor (acyl-ACP or acyl-CoA): typically 10-100 μM

  • For bi-substrate kinetics, use a matrix of concentrations

Enzyme Stability Factors:

  • Reducing agents (DTT or β-mercaptoethanol, 1-5 mM) to maintain thiol groups

  • Glycerol (10-20%) to enhance stability during storage and assays

  • Detergents (0.01-0.1% CHAPS or Triton X-100) for membrane-associated enzyme variants

Detection Methods:

  • Spectrophotometric: DTNB (Ellman's reagent) for CoA detection

  • Radiometric: [³H] or [¹⁴C]-labeled substrates for highest sensitivity

  • Chromatographic: HPLC or TLC for product identification and quantification

  • Mass spectrometry: LC-MS/MS for comprehensive product analysis

Optimal conditions should be determined experimentally for each specific recombinant Shewanella plsY variant, as adaptation to different environments may result in significant variation in optimal parameters between species or strains .

What troubleshooting approaches are effective when recombinant Shewanella plsY shows low activity?

When recombinant Shewanella plsY exhibits low activity, a systematic troubleshooting approach can identify and address potential issues at various stages of expression, purification, and assay conditions.

Expression and Protein Quality Issues:

  • Verify Expression Levels:

    • Confirm protein expression using Western blotting with specific antibodies

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider codon optimization if expressing in heterologous systems

  • Assess Protein Solubility and Folding:

    • Analyze fractionation between soluble and membrane/insoluble fractions

    • Implement solubility tags (MBP, SUMO) if aggregation is occurring

    • Co-express with chaperones to assist proper folding

  • Membrane Association:

    • For membrane-associated acyltransferases, ensure proper membrane targeting

    • Use mild detergents for extraction from membranes

    • Consider reconstitution into liposomes or nanodiscs to provide lipid environment

Enzyme Stability and Activity Conditions:

  • Buffer Optimization:

    • Test multiple buffer systems (HEPES, Tris, phosphate) at various pH values

    • Optimize ionic strength based on the natural habitat of the Shewanella species

    • Include stabilizing agents (glycerol, reducing agents) to prevent denaturation

  • Cofactor Requirements:

    • Screen divalent metal ions (Mg²⁺, Mn²⁺, Zn²⁺) as potential cofactors

    • Test substrate quality and purity

    • Examine requirement for specific phospholipids as activators

  • Temperature Effects:

    • For cold-adapted Shewanella species, ensure assays are conducted at appropriate temperatures

    • Implement temperature gradients to identify activity optima

    • Compare with temperature dependence of related enzymes 3

Systematic Troubleshooting Protocol:

Table 4: Structured Troubleshooting Approach for Low plsY Activity

Issue CategoryDiagnostic TestPotential SolutionsExpected Outcome
Expression problemsSDS-PAGE and Western blot analysisOptimize induction parameters, Change expression systemConfirmed presence of target protein
Protein misfoldingCircular dichroism spectroscopyRefold protein, Co-express with chaperonesProper secondary structure elements
Membrane association issuesMembrane fractionationUse mild detergents, Reconstitute in lipid environmentEnrichment in membrane fraction
Substrate problemsLC-MS analysis of substratesUse fresh substrate preparations, Verify substrate purityConfirmed substrate quality
Assay interferenceControl reactions with known enzyme standardsIdentify and eliminate interfering componentsValidated assay system
Enzyme stabilityThermal shift assay, Activity time courseAdd stabilizing agents, Optimize buffer conditionsImproved stability profile
Cofactor requirementsActivity screening with various additivesSupplement with potential cofactorsIdentified essential components

Functional Validation Approaches:

  • Conduct complementation assays in plsY-deficient strains

  • Compare activity with related acyltransferases from other organisms

  • Use in vivo assays to assess functionality in the cellular context

By systematically addressing these potential issues, researchers can identify and resolve factors limiting recombinant Shewanella plsY activity, ultimately enabling successful characterization and application of the enzyme.

How can isothermal titration calorimetry (ITC) be applied to characterize substrate binding of Shewanella plsY?

Isothermal titration calorimetry (ITC) represents a powerful biophysical technique for characterizing the thermodynamics of substrate binding to recombinant Shewanella plsY. This label-free approach directly measures heat changes during binding events, providing comprehensive binding parameters and mechanistic insights.

Experimental Design for ITC Analysis:

  • Sample Preparation Requirements:

    • Highly purified recombinant plsY (typically 10-50 μM in cell)

    • Glycerol-3-phosphate or acyl donor substrates (typically 200-500 μM in syringe)

    • Buffer matching with minimal heats of dilution (phosphate or HEPES preferred)

    • Degassed samples to prevent bubble formation during measurement

  • Optimal Measurement Parameters:

    • Temperature range: 5-25°C (covering physiological range for Shewanella species)

    • Reference power: 10-20 μcal/sec

    • Injection sequence: 20-25 injections of 2-10 μL each

    • Spacing between injections: 180-300 seconds to ensure return to baseline

Data Analysis and Interpretation:

Table 5: Key Thermodynamic Parameters from ITC Analysis

Research Applications for plsY Characterization:

  • Substrate Specificity Profiling:

    • Comparative binding analysis of different acyl donors

    • Determination of substrate preference hierarchy

    • Correlation with natural fatty acid composition in Shewanella membranes

  • Temperature-Dependent Studies:

    • Measurements at multiple temperatures to obtain enthalpy-entropy compensation profiles

    • Calculation of heat capacity changes (ΔCp) related to hydrophobic interactions

    • Comparison between psychrophilic and mesophilic Shewanella plsY variants

  • Mutational Analysis:

    • Parallel analysis of wild-type and mutant proteins

    • Identification of residues critical for substrate recognition

    • Quantification of energetic contributions of specific amino acids

  • Inhibitor Screening and Characterization:

    • Determination of inhibition constants and mechanisms

    • Structure-activity relationships for potential inhibitors

    • Competition studies to identify binding site overlap

ITC data, when integrated with enzymatic activity measurements and structural information, provides a comprehensive understanding of the molecular basis for substrate recognition and catalysis by Shewanella plsY, particularly in the context of environmental adaptations that distinguish different Shewanella species.

How should researchers analyze phospholipid profiles to assess the in vivo function of recombinant Shewanella plsY?

Experimental Design for Phospholipid Profiling:

  • Genetic System Preparation:

    • Generate plsY knockout or conditional mutants in Shewanella

    • Complement with recombinant wild-type or mutant plsY variants

    • Create control strains with vector-only or catalytically inactive enzyme

    • The λ Red recombineering system from Shewanella sp. W3-18-1 with ~5% recombination efficiency offers an effective approach for genetic manipulation

  • Growth Conditions:

    • Culture strains under standard and stress conditions (temperature, salinity)

    • Include growth at low temperatures (4-15°C) to examine cold adaptation effects

    • Consider growth with supplemental fatty acids to test acyl chain incorporation

  • Lipid Extraction and Analysis:

    • Total lipid extraction using Bligh-Dyer or similar methods

    • Fractionation of phospholipid classes by TLC or SPE

    • Quantitative analysis by LC-MS/MS or GC-MS

Analytical Framework:

Table 6: Comprehensive Phospholipid Analysis Workflow

Data Integration and Interpretation:

  • Statistical Analysis:

    • Multivariate analysis (PCA, hierarchical clustering) to identify patterns

    • ANOVA with post-hoc tests to determine significant differences

    • Correlation analysis between enzyme activity and specific lipid parameters

  • Phenotypic Correlation:

    • Link phospholipid changes to growth rates under various conditions

    • Assess cell morphology changes (e.g., filamentous growth at low temperature)

    • Measure membrane-associated functions (permeability, transport)

  • Evolutionary Context:

    • Compare profiles across different Shewanella species

    • Relate membrane composition to environmental adaptations

    • Consider strain-specific metabolic capabilities that might influence lipid profiles

This integrated analytical approach provides a comprehensive assessment of how recombinant plsY variants influence membrane composition in vivo, connecting molecular function to cellular physiology and environmental adaptation in Shewanella species.

What comparative approaches can distinguish species-specific adaptations in Shewanella plsY function?

Distinguishing species-specific adaptations in Shewanella plsY function requires multifaceted comparative analyses that integrate evolutionary, structural, and functional perspectives. This approach can reveal how diverse Shewanella species have optimized plsY function for their specific ecological niches, from deep-sea environments to cold Antarctic waters.

Evolutionary Sequence Analysis:

  • Phylogenetic Framework:

    • Construct phylogenetic trees of plsY sequences from diverse Shewanella species

    • Correlate sequence clades with habitat parameters (temperature, pressure, salinity)

    • Identify positively selected residues using dN/dS analysis

  • Sequence-Structure-Function Correlation:

    • Map conserved vs. variable regions across Shewanella species

    • Identify species-specific insertions/deletions or domain arrangements

    • Predict functional implications of sequence variations using homology modeling

Comparative Functional Characterization:

Table 7: Multi-Parameter Comparative Analysis Framework

ParameterMeasurement ApproachSpecies ComparisonAdaptation Indicators
Temperature optimaActivity profiles (0-45°C)Cold-adapted vs. mesophilic speciesShifted optima reflecting habitat temperature
Substrate specificityActivity with various acyl donorsSpecies from different habitatsPreference matching available fatty acids in niche
Catalytic efficiencykcat/Km determinationAcross phylogenetic spectrumOptimization for substrate availability in habitat
Thermal stabilityThermal denaturation curvesPsychrophilic vs. mesophilic strainsStability-activity trade-offs in cold adaptation
pH dependenceActivity across pH rangeMarine vs. freshwater isolatesAdaptation to environmental pH constraints
Salt toleranceActivity with varying ionic strengthMarine vs. non-marine speciesHalotolerance reflecting natural habitat

Complementation Studies:

  • Cross-Species Functional Replacement:

    • Express plsY from different Shewanella species in a common host

    • Test complementation of growth defects under various conditions

    • Analyze resulting membrane compositions to assess functional equivalence

  • Domain Swapping Experiments:

    • Create chimeric enzymes with domains from different species

    • Map functional differences to specific protein regions

    • Identify critical regions for environmental adaptation

Integrated Data Analysis:

  • Adaptation Signatures:

    • Cold adaptation: Lower temperature optima, maintained activity at low temperatures, altered substrate specificity for unsaturated fatty acids

    • Pressure adaptation: Structural modifications affecting volume change during catalysis

    • Halotolerance: Surface charge distribution optimized for high salt environments

  • Correlation with Whole-Organism Phenotypes:

    • Growth rate vs. enzyme kinetic parameters

    • Membrane fluidity vs. substrate preferences

    • Stress response capabilities vs. enzyme stability profiles

This comprehensive comparative approach can reveal how natural selection has shaped plsY function in different Shewanella species, providing insights into both the molecular mechanisms of enzyme adaptation and the ecological significance of these adaptations for survival in diverse environments.

What are the most significant challenges in researching recombinant Shewanella plsY and how can they be addressed?

Research on recombinant Shewanella plsY presents several significant challenges that span from fundamental biological complexities to technical limitations. Addressing these challenges requires integrated approaches that combine genetic, biochemical, and computational methods.

Current Research Challenges and Solutions:

  • Membrane Association and Solubility:

    • Challenge: plsY is typically membrane-associated, complicating expression and purification.

    • Solution: Implement membrane-mimetic systems (nanodiscs, detergent micelles) for purification and assays. The development of robust electroporation methods for Shewanella with efficiency of ~4.0 × 10^6 transformants/μg DNA enables direct homologous expression in native membrane environments .

  • Species-Specific Functional Context:

    • Challenge: Significant metabolic diversity exists across Shewanella species, with strain-specific utilization of carbon, phosphate, and sulfur sources .

    • Solution: Conduct comparative studies across multiple species and create standardized assay conditions that account for ecological diversity.

  • Complex Regulation and Interaction Networks:

    • Challenge: plsY function may depend on protein-protein interactions and regulatory networks specific to Shewanella.

    • Solution: Implement in vivo approaches alongside in vitro studies, including subcellular localization analysis similar to that performed for plsC in S. livingstonensis .

  • Cold Adaptation Mechanisms:

    • Challenge: Understanding how plsY contributes to membrane adaptation at low temperatures in psychrophilic Shewanella species.

    • Solution: Integrate membrane composition analysis with enzyme kinetics under temperature stress conditions, examining temperature-activity relationships alongside membrane physical properties.

  • Heterologous Expression Limitations:

    • Challenge: Obtaining functional enzyme when expressed in heterologous systems.

    • Solution: Leverage the λ Red recombineering system adapted from Shewanella sp. W3-18-1 for precise genetic manipulation in native hosts .

Emerging Approaches:

  • Systems Biology Integration:

    • Connect plsY function to global cellular responses through transcriptomics and metabolomics

    • Develop computational models of phospholipid metabolism specific to Shewanella

  • Environmental Relevance:

    • Study plsY function under conditions mimicking natural Shewanella habitats

    • Connect molecular function to ecological fitness under environmentally relevant stressors

    • Examine adaptation mechanisms in relation to bioremediation applications, building on Shewanella's versatile respiratory capabilities

  • Structural Biology Frontiers:

    • Apply cryo-EM to visualize membrane-associated enzyme complexes

    • Implement hydrogen-deuterium exchange mass spectrometry to map dynamic regions

By addressing these challenges through interdisciplinary approaches, researchers can advance understanding of Shewanella plsY, contributing to broader knowledge of bacterial membrane biology, environmental adaptation, and potential biotechnological applications.

How might future research directions on Shewanella plsY advance understanding of bacterial membrane adaptation?

Future research on Shewanella plsY holds significant potential to advance understanding of bacterial membrane adaptation mechanisms, particularly in relation to environmental stress responses and niche specialization. By leveraging the diverse ecological adaptations observed across Shewanella species , researchers can explore fundamental questions about phospholipid biosynthesis and membrane homeostasis.

Promising Research Directions:

  • Mechanistic Basis of Temperature Adaptation:

    • Investigate how plsY structural modifications enable function across temperature ranges

    • Determine whether substrate preferences shift with temperature to maintain optimal membrane fluidity

    • Explore potential synchronization mechanisms between plsY and plsC activities in cold adaptation, building on observations that plsC1 is essential for proper cell division at low temperatures in S. livingstonensis

  • Integrated Membrane Remodeling Networks:

    • Map the interaction networks between plsY and other membrane biogenesis proteins

    • Identify regulatory mechanisms that coordinate membrane lipid composition in response to environmental changes

    • Characterize potential metabolic channeling between plsY and downstream enzymes

  • Evolutionary Diversification:

    • Conduct comprehensive phylogenetic analyses of plsY across the Shewanella genus

    • Identify convergent evolutionary strategies in distantly related extremophiles

    • Reconstruct ancestral sequences to test evolutionary hypotheses about adaptation

  • Synthetic Biology Applications:

    • Engineer plsY variants with altered substrate specificities to produce designer membrane compositions

    • Develop Shewanella-based platforms for production of specialty lipids

    • Create synthetic membrane adaptation circuits for biotechnology applications

Technological Innovations Enabling Progress:

  • Genome Engineering Approaches:

    • Apply the λ Red recombineering system from Shewanella sp. W3-18-1 for precise genome editing with ~5% recombination efficiency

    • Implement CRISPR-Cas systems adapted for Shewanella

    • Develop high-throughput mutagenesis pipelines for comprehensive structure-function mapping

  • Advanced Analytical Methods:

    • Single-molecule tracking of fluorescently tagged plsY to visualize dynamics

    • Lipidomic flux analysis using stable isotope labeling

    • Native mass spectrometry to identify protein-protein interactions in membrane contexts

  • Computational Modeling:

    • Molecular dynamics simulations of plsY in species-specific membrane environments

    • Machine learning approaches to predict substrate specificity from sequence

    • Multi-scale modeling connecting molecular function to cellular physiology

Broader Impacts:

Research on Shewanella plsY can serve as a model system for understanding fundamental principles of enzyme adaptation to extreme environments, with implications for:

  • Understanding microbial community dynamics in changing environments

  • Designing robust biocatalysts for industrial applications

  • Developing strategies to target membrane biosynthesis in pathogenic bacteria

  • Engineering microorganisms with enhanced stress resistance for bioremediation applications, building on Shewanella's natural capabilities for metal reduction and diverse respiratory pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.