Recombinant Shewanella sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Shewanella sp. Large-Conductance Mechanosensitive Channel (MscL)

Shewanella sp. Large-conductance mechanosensitive channel (MscL) is a recombinant protein derived from the Shewanella species, specifically strain MR-4 . MscL is a mechanosensitive channel, which means it responds to mechanical stimuli such as changes in pressure or membrane tension . These channels are found in the cell membranes of various organisms, including bacteria, and play a crucial role in protecting cells from osmotic shock by opening pores in response to membrane stretching, thus releasing solutes to reduce turgor pressure .

Characteristics of Shewanella MscL

CharacteristicDescription
SourceShewanella sp. (strain MR-4)
Product TypeRecombinant Protein
Uniprot NO.Q0HMW6
Tag InfoDetermined during production
Storage BufferTris-based buffer, 50% glycerol
AA SequenceMSLIKEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVADIIMPPIGIILGGVNFSDLSIVLQAAQGDAPAVVIAYGKFIQTVIDFTIIAFAIFMGLKAINSLKRKQEEAPKAPPAPTKDQELLSEIRDLLKAQQEK
Gene NamemscL
Ordered Locus NamesShewmr4_0521
Expression Region1-136

Biological Significance and Function

MscL channels are essential for bacterial survival under hypoosmotic conditions. When a bacterium encounters a sudden decrease in external osmolarity, water rushes into the cell, causing the cell membrane to stretch. MscL channels respond to this stretching by opening, allowing ions and small molecules to flow out of the cell, thereby reducing the internal pressure and preventing lysis.

Role in Protein Excretion

Studies have indicated that MscL plays a direct role in the excretion of recombinant proteins into the periplasm of E. coli . When MscL is deficient, there is a significant decrease in periplasmic localization of recombinant proteins, suggesting that MscL is involved in the translocation of proteins across the cell membrane .

Shewanella Species and Their Implications

Shewanella species are Gram-negative bacilli found in various environments, including freshwater, marine environments, and even spoiled food products . They are known for their ability to use metals as electron acceptors in anaerobic respiration . While some Shewanella species are involved in food spoilage, others can cause infections in humans, particularly in individuals with underlying health conditions such as hepatobiliary diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Shewana3_0520; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Shewanella sp. (strain ANA-3)
Target Names
mscL
Target Protein Sequence
MSLIKEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVADIIMPPIGIILGGVNFSDLSIV LQAAQGDAPAVVIAYGKFIQTIIDFTIIAFAIFMGLKAINSLKRKQEEAPKAPPAPTKDQ ELLSEIRDLLKAQQEK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the MscL protein and what is its function in Shewanella species?

    MscL (Large-conductance mechanosensitive channel) is a membrane protein that forms a homopentameric channel in Shewanella species. It opens in response to stretch forces in the lipid bilayer and acts as a turgor pressure release valve critical for bacterial survival during osmotic shock . The channel prevents cell lysis by allowing rapid efflux of osmolytes when cells face hypo-osmotic conditions. In Shewanella species, which are known for their diverse respiratory capabilities and bioremediation potential, MscL serves as an essential component for stress adaptation and survival in changing environmental conditions .

  • How does the MscL channel respond to mechanical stimuli?

    The MscL channel responds to mechanical stimuli through the bilayer mechanism, which involves hydrophobic mismatch, changes in membrane curvature, and alterations in the transbilayer pressure profile . When bacterial cell membrane experiences tension, lateral forces in the lipid bilayer directly trigger conformational changes in the MscL protein, causing it to expand from a closed to an open state. This transition involves:

    • Tilting and straightening of kinked pore-forming transmembrane helices (TM3) during barrel expansion

    • A 53° axial rotation of TM3s that increases pore width and polarity

    • Creation of a water-filled channel approximately 1.6 nm wide

    These structural changes result in a non-saturable conductance of approximately 1.2 nS in standard electrolyte conditions with weak preference for anions .

  • How is recombinant MscL from Shewanella typically expressed and purified?

    Expressing recombinant Shewanella MscL requires specialized genetic tools and expression systems. A methodological approach includes:

    StepProcedureKey Considerations
    1. Vector SelectionChoose appropriate synthetic plasmid toolkit for Shewanella sp.Compatibility with Shewanella, appropriate promoters, replication origins
    2. TransformationUse conjugation for introducing DNA into ShewanellaE. coli WM3064 (DAP auxotroph) as donor cells
    3. Expression ControlFine-tune expression using inducible promotersRegulate inducer concentrations and induction times
    4. PurificationExtract and purify protein using affinity tagsTag type determined during production process
    5. StorageStore in optimized buffer conditionsTris-based buffer with 50% glycerol at -20°C or -80°C

    The synthetic plasmid toolkit developed for S. oneidensis MR-1 enables rapid and convenient fine-tuning of gene expression with greater controllability and predictability, which accelerates genetic manipulations .

  • What experimental techniques are commonly used to study MscL function?

    Several experimental techniques are essential for studying MscL function:

    1. Patch-clamp electrophysiology: Direct measurement of channel conductance and gating properties through application of calibrated suction pressures to membrane patches .

    2. Protein reconstitution in vitro: Solubilizing and fractionating bacterial envelope components, then reconstituting MscL activity in artificial membrane systems .

    3. Genetic manipulation: Employing recombineering systems and electroporation methods for Shewanella that allow precise genome editing with efficiencies of ~5% recombinants among total cells .

    4. Fluorescence measurements: Using reporter proteins like GFP to quantify expression levels and localization patterns, with fluorescence intensity correlating with copy number of expression plasmids .

    5. Molecular dynamics simulations: Applying computational methods like extrapolated motion protocol and all-atom simulations to study conformational changes during channel opening .

  • How is the mscL gene distributed across different Shewanella species?

    The distribution of the mscL gene across Shewanella species shows considerable variation, reflecting the significant genomic diversity within this genus . Recent comparative genomic analyses have revealed that:

    • The mscL gene is present in multiple Shewanella species, including S. baltica, S. oneidensis, and S. xiamenensis

    • In S. baltica (strain OS185), mscL is identified by the ordered locus name Shew185_3845

    • Whole-genome multilocus sequence typing (wgMLST) analyses show significant diversity among Shewanella isolates, suggesting potential variation in mscL gene sequences and regulatory elements

    • The extensive genomic diversity makes it challenging to generalize findings from one Shewanella strain to another, necessitating species-specific characterization of MscL

    The accurate identification of Shewanella species is critical when studying mscL distribution, as misidentification between closely related species like S. putrefaciens, S. seohaensis, and S. xiamenensis has been frequently reported in the literature .

Advanced Research Questions

  • What molecular mechanisms determine MscL gating kinetics in different Shewanella species?

    The molecular mechanisms governing MscL gating kinetics in Shewanella species involve complex interactions between protein structure and membrane properties. Critical factors include:

    1. Transmembrane domain interactions: The tilting and straightening of pore-forming helices during barrel expansion is crucial for channel opening .

    2. Hydrophobic gating region: The channel contains a hydrophobic constriction that prevents ion passage in the closed state but becomes hydrated upon channel opening .

    3. Membrane thickness sensitivity: MscL responds to hydrophobic mismatch between protein hydrophobic surfaces and the lipid bilayer, with thinner membranes facilitating channel opening .

    4. Species-specific adaptations: The significant genomic diversity among Shewanella species suggests adaptations in MscL structure and function that may reflect their ecological niches .

    5. Rotational component: A 53° spontaneous axial rotation of transmembrane helices observed in MscS (and potentially similar in MscL) increases pore width and polarity, facilitating ion permeation .

    These mechanisms collectively contribute to the tension-dependent gating that allows MscL to respond precisely to mechanical stimuli in the membrane environment.

  • How can MscL be engineered for specific applications in neuronal mechanosensitivity?

    Engineering MscL for neuronal mechanosensitivity applications involves systematic modifications and validation steps:

    1. Heterologous expression optimization: Adapting the bacterial channel for functional expression in mammalian neurons without cytotoxicity .

    2. Sensitivity tuning: Modifying key residues to adjust the tension threshold required for channel opening, creating variants with different mechanical sensitivities .

    3. Neuronal compatibility verification: Assessing the impact on cell survival, number of synaptic puncta, and spontaneous network activity to ensure the engineered channel doesn't disrupt normal neuronal function .

    4. Functional validation: Performing patch-clamp recordings upon application of calibrated suction pressures to verify mechanosensitivity in the neuronal membrane environment .

    5. Cell-type specificity: Leveraging cell-type-specific promoters to target expression to particular neuronal populations for selective mechanosensitization .

    The pure mechanosensitivity of engineered MscL, combined with its wide genetic modification library, makes it a versatile tool for developing mechano-genetic approaches for non-invasive neuromodulation .

  • What role does MscL play in protein excretion across the inner membrane in Shewanella?

    MscL plays a critical role in protein excretion across the inner membrane in Shewanella and other bacteria through a complex mechanism linking osmotic stress and translation stress:

    ConditionEffect on MscL-Dependent ExcretionExperimental Evidence
    Hypo-osmotic stressPromotes protein excretionDecreased medium osmolality (from ~346 to ~250 mOsm) correlates with excretion
    Maintained osmolalityInhibits excretionNo excretion observed in media with stable osmolality (~450-461 mOsm)
    Translation stressRequired for excretionProteome analysis found translation stress response signatures associated with excretion
    MscL deletionPrevents excretionΔmscl mutants showed 5-fold decrease in periplasmic protein localization
    MscL restorationRescues excretionEpisomal expression of MscL recovered the excretion phenotype

    This excretion mechanism involves a direct linkage between osmotic stress, the Alternative ribosome rescue factor A (ArfA)-mediated response to translational stress, and MscL-dependent excretion . The physiological relevance of this phenomenon has been validated in both recombinant protein-expressing and wild-type bacterial backgrounds .

  • How do the electrophysiological properties of Shewanella MscL compare to other bacterial mechanosensitive channels?

    The electrophysiological properties of Shewanella MscL show both similarities and differences compared to other bacterial mechanosensitive channels:

    PropertyShewanella MscLE. coli MscLE. coli MscSNotes
    ConductanceLarge (similar to E. coli MscL)~1.2 nSSmaller than MscLMscL has approximately 3× higher conductance than MscS
    Ion selectivityWeak preference for anionsWeak preference for anionsWeak preference for anionsSelectivity increases with higher voltages
    Gating thresholdResponds to membrane tension~10-12 mN/m~5-8 mN/mMscL requires higher tension to open than MscS
    StructureHomopentamerHomopentamerHomoheptamerDifferent oligomeric organization affects pore size
    Water fluxSignificant electroosmotic water transportSignificant~8 waters per Cl⁻Water movement strongly correlates with ion flux

    These properties make Shewanella MscL particularly suitable for applications requiring large-conductance mechanosensitive responses, such as protein excretion systems and engineered mechanosensitivity in non-native contexts .

  • What are the advantages of using Shewanella MscL for mechanogenetic applications compared to other mechanosensitive channels?

    Shewanella MscL offers several distinct advantages for mechanogenetic applications:

    1. Pure mechanosensitivity: Unlike channels that respond to multiple stimuli, MscL responds specifically to mechanical forces, enabling precise mechano-genetic approaches with minimal cross-talk .

    2. Extensive genetic modification library: The channel has been thoroughly characterized, with numerous variants engineered for different properties, providing researchers with a diverse toolkit .

    3. Neuronal compatibility: Studies have demonstrated successful functional expression in neuronal networks without compromising cell viability or network activity .

    4. Non-invasive stimulation potential: Mechanical stimuli represent promising vectors to convey information non-invasively into intact brain tissue, with MscL providing the required sensitivity .

    5. Large conductance: The substantial ion flux through MscL upon activation ensures robust cellular responses to mechanical stimuli .

    6. Relatively simple structure: With only 136 amino acids and a straightforward pentameric architecture, MscL is amenable to rational design approaches .

    These advantages make Shewanella MscL particularly valuable for developing cell-type-specific stimulation approaches in neuroscience research and potential therapeutic applications .

  • How does environmental stress affect MscL expression and function in Shewanella species?

    Environmental stress significantly impacts MscL expression and function in Shewanella species through multiple regulatory mechanisms:

    1. Osmotic regulation: MscL is up-regulated during osmotic shock to prevent cell lysis, with expression levels increasing in response to hypo-osmotic conditions .

    2. Growth phase dependence: During stationary phase, MscL protein is up-regulated, suggesting integration with general stress response systems .

    3. Translation stress connection: Condition-specific proteome analysis has revealed a strong association between translation stress response signatures and MscL-dependent protein excretion .

    4. Medium composition effects: The absence of protein excretion in growth media containing sodium chloride suggests ionic composition directly affects MscL function .

    5. Temperature adaptation: Given Shewanella species' diverse environmental niches, from deep-sea to clinical isolates, MscL likely exhibits temperature-dependent regulatory patterns similar to other membrane proteins in this genus .

    These regulatory mechanisms allow Shewanella species to adapt to changing environmental conditions while maintaining membrane integrity through appropriate MscL expression and activation .

  • What biotechnological applications could leverage Shewanella MscL's unique properties?

    Shewanella MscL's unique properties enable diverse biotechnological applications:

    1. Protein secretion systems: Leveraging MscL-dependent protein excretion for secretion of recombinant proteins without cell lysis, potentially achieving titers of 0.7 g/liter and up to 80% purity .

    2. Biosensors for mechanical stimuli: Developing cellular sensors that respond to specific mechanical forces by coupling MscL to reporter systems .

    3. Controlled release systems: Engineering cells with modified MscL variants that release bioactive compounds upon specific mechanical triggers .

    4. Neural interfaces: Creating non-invasive neuromodulation approaches through mechano-sensitization of specific neuronal populations .

    5. Drug discovery platforms: Using MscL as a target for identifying compounds that modulate mechanosensitive channels, potentially leading to new antibiotics against multiple drug-resistant bacterial strains .

    6. Bioremediation enhancement: Optimizing Shewanella's natural bioremediation capabilities for toxic and radioactive metals by controlling stress responses through MscL modulation .

    The synthetic plasmid toolkit developed for Shewanella provides the necessary genetic tools to implement these applications with precise control over expression levels .

  • How might alterations in the MscL amino acid sequence affect channel function across Shewanella strains?

    Alterations in the MscL amino acid sequence can profoundly impact channel function across different Shewanella strains. Key mechanistic effects include:

    1. Gating threshold modifications: Mutations in the hydrophobic constriction region can dramatically alter the tension required for channel opening, creating hypersensitive or hyposensitive variants .

    2. Conductance changes: Alterations in pore-lining residues affect channel conductance by modifying pore diameter, surface charge distribution, and hydration patterns .

    3. Ion selectivity shifts: Mutations that introduce charged residues can enhance or diminish the channel's slight preference for anions, potentially creating variants with stronger selectivity .

    4. Strain-specific adaptations: The considerable diversity within Shewanella species suggests evolutionary adaptations in MscL sequence that optimize function for specific environmental niches .

    5. Protein-lipid interaction differences: Variations in transmembrane domains can alter how the channel senses and responds to membrane tension through changes in hydrophobic matching .

    These sequence variations make it critical to characterize MscL from specific Shewanella strains rather than generalizing findings, particularly when considering biotechnological applications .

  • What challenges must be overcome when expressing recombinant Shewanella MscL in heterologous systems?

    Expressing recombinant Shewanella MscL in heterologous systems presents several significant challenges:

    1. Membrane composition compatibility: The lipid environment significantly affects MscL function, requiring optimization for different host systems .

    2. Codon usage optimization: Adapting the Shewanella codon bias to match the heterologous expression host is essential for efficient translation .

    3. Toxicity management: Constitutive expression of an active mechanosensitive channel may disrupt host cell osmotic balance, necessitating inducible or tightly regulated expression systems .

    4. Proper membrane targeting: Ensuring correct localization to the plasma membrane requires appropriate signal sequences and membrane insertion machinery .

    5. Functional validation methodologies: Developing appropriate assays to confirm channel function in the heterologous system, such as patch-clamp electrophysiology or osmoprotection assays .

    6. Expression level control: Fine-tuning expression using characterized promoters with different strengths and induction parameters to achieve optimal protein levels .

    7. System-specific optimization: Different applications (neuronal networks, protein secretion, etc.) require tailored expression strategies based on the host system's properties .

    Addressing these challenges requires a multifaceted approach combining genetic engineering, membrane biology, and electrophysiological characterization techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.