Recombinant Shewanella sp. Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Inward-Facing Conformation

  • X-ray structure (2.8 Å): Reveals a transmembrane portal widening to accommodate lipid A entry .

  • Lipid A binding: Electron density maps show lipid A trapped in the central cavity and periplasmic cleft, supporting a "trap and flip" mechanism .

Conformational Flexibility (Cryo-EM Analysis)

  • Environmental sensitivity: Detergents stabilize wide nucleotide-binding domain (NBD) separations, while nanodiscs induce narrow conformations .

  • Functional spectrum: Only 3/12 tested environments permit full NBD movement, essential for ATPase activity .

Functional Mechanism

MsbA operates as a lipid flippase with dual roles:

  1. Primary substrate: Transports lipid A (endotoxin precursor) and LPS core regions .

  2. Secondary role: Facilitates glycerophospholipid flipping under stress conditions .

ATPase Cycle:

  • ATP binding induces NBD dimerization, driving conformational shifts from inward- to outward-facing states .

  • Lipid A translocation is coupled to ATP hydrolysis, enabling energy-dependent flipping .

Research Applications

  • Antibiotic development: Essential for Gram-negative bacterial viability, making MsbA a drug target .

  • Membrane biology: Used to study ABC transporter dynamics via molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) .

Comparative Analysis of Recombinant Variants

FeatureFull-Length MsbA (MR-7) Partial MsbA (MR-7)
Expression Region1-601Undefined partial sequence
Tag FlexibilityHis tag (fixed)Determined during manufacturing
Reconstitution0.1–1.0 mg/mL in Tris/PBS + glycerolSimilar protocol
Stability1 week at 4°C6–12 months at -80°C

Challenges and Innovations

  • Crystallization hurdles: Solved using facial amphiphiles (e.g., FA-3) to stabilize lipid-bound states .

  • Conformational mapping: Cryo-EM advances (2024) enable tracking of MsbA dynamics in near-native membranes .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; Shewmr7_2492; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Shewanella sp. (strain MR-7)
Target Names
msbA
Target Protein Sequence
MTASPKDEMWTVFKRLLGYLKPMKGMFLLSVCGLIVYGLVDAAFISFIGPFIDKGFSSST PAISNGIALPTSQGFHADNQVLLMAPIVVILMFSLRGFANFVSTYGISYMSARLIMDMRQ QVFEHYLSLPVSYMDKENTGNLISKVTFDTEQIARASGSALISIVRDGVTVIGMLGLMFY NSWKLSLCILVIGPIMGLVITIVSRRFRKVSKQIQTAMGDVSAATEQMIKGHKNVLAFGG QETETARFAKINDRNRHQNMKLAVAQAVSQPLIMVIGSFALAFVLYAASLDSMKADLTAG TFATILGAMMAMLQPIKNLTRVNAEFQRGIAACTTVFELLDTLPESDTGTYTVKRAKGNL RFDNVSFSYEGQERRALDKIDFEVTQGQTLALVGRSGSGKSTIASLVTRFYTGLESGDIK LDDVSIYDYSLKSLRSQVALVSQQVTLFNDTIANNIAYAYPGEATREQIIQAATLAHAME FIEQLPEGLDTQVGENGVLLSGGQRQRIAIARAMLRDAPVLILDEATSALDTESEKAIQQ GLDNLRQNRTSVVIAHRLSTIESADQILVVDQGRIVERGTHKSLLELGGMYAKLYQMQFG S
Uniprot No.

Target Background

Function
MsbA, the Lipid A export ATP-binding/permease protein, is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of MsbA protein in Shewanella sp.?

MsbA is an ATP-binding cassette (ABC) transporter consisting of 601 amino acids in Shewanella species. The protein functions as a lipid A export ATP-binding/permease protein, essential for membrane biogenesis. Structurally, MsbA contains transmembrane domains (TMDs) that anchor the protein in the membrane and nucleotide-binding domains (NBDs) responsible for ATP hydrolysis. The full amino acid sequence (1-601) features characteristic ABC transporter motifs and domains with a complex secondary structure that facilitates substrate transport across cellular membranes .

Research methodological considerations: When studying MsbA structure, researchers should employ a combination of X-ray crystallography, cryo-electron microscopy, and NMR spectroscopy to gain comprehensive insights into both static and dynamic structural properties.

How does Shewanella sp. MsbA compare with MsbA from other bacterial species?

Methodological approach: Comparative sequence analysis using multiple sequence alignment tools followed by homology modeling can help identify conserved domains versus variable regions. Functional studies comparing transport kinetics and substrate specificity between MsbA from different species will highlight evolutionary adaptations.

What are the optimal conditions for recombinant expression of Shewanella sp. MsbA?

The recombinant Shewanella sp. MsbA protein is optimally expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. Expression vectors should contain strong inducible promoters (such as T7) to control protein production. Expression temperature, typically lowered to 18-20°C after induction, helps prevent inclusion body formation of this membrane protein. Inducer concentration and duration of expression should be optimized to balance protein yield and functional integrity .

Methodological protocol: Transform expression vector into an E. coli strain optimized for membrane protein expression (C41, C43, or Lemo21). Culture cells at 37°C until OD600 of 0.6-0.8, then induce with IPTG (0.1-0.5 mM) and continue expression at 18°C for 16-20 hours. Include membrane-stabilizing agents in the growth medium to enhance functional protein yield.

What purification strategies yield the highest purity and activity for recombinant Shewanella MsbA?

Purification of recombinant Shewanella MsbA requires a multi-step approach:

  • Membrane preparation: Careful cell lysis followed by differential centrifugation

  • Solubilization: Use of appropriate detergents (DDM, LMNG, or UDM)

  • Affinity chromatography: Ni-NTA purification utilizing the His-tag

  • Size exclusion chromatography: To remove aggregates and ensure monodispersity

The purified protein should be maintained in a buffer containing Tris/PBS with 6% trehalose at pH 8.0, with recommended addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

Methodological considerations: Monitoring protein activity throughout purification is essential. ATPase assays should be performed at each purification stage to ensure the final product retains functional activity.

How can the allosteric coupling between NBD and TMD domains in Shewanella MsbA be experimentally probed?

The allosteric communication between nucleotide-binding domains (NBDs) and transmembrane domains (TMDs) in MsbA can be investigated using solid-state NMR spectroscopy, as demonstrated in recent studies. This approach reveals the critical role of coupling helices (CH1 and CH2) in mediating this interdomain communication. Site-directed mutagenesis studies suggest differential contributions of these coupling helices, with CH2 mutations showing stronger effects on ATPase activity compared to CH1 mutations .

Methodological approach: A comprehensive investigation should combine:

  • Solid-state NMR to detect conformational changes upon nucleotide binding

  • Site-directed mutagenesis of residues in coupling helices

  • ATPase assays to measure functional consequences of mutations

  • Molecular dynamics simulations to model allosteric communication pathways

What are the structural determinants of substrate specificity in Shewanella MsbA?

The substrate specificity of Shewanella MsbA is determined by specific residues within the transmembrane domains that form the substrate-binding pocket. Research should focus on identifying these key residues through a combination of structural analysis, computational docking studies, and functional assays with various substrates. Lipid A and other membrane components likely interact with specific amino acid clusters in the transmembrane regions of the protein.

Methodological strategy: Employ a combination of:

  • Homology modeling based on crystallographic structures of related ABC transporters

  • Substrate docking simulations

  • Site-directed mutagenesis of predicted binding site residues

  • Transport assays with fluorescently labeled substrates

  • Cross-linking studies to capture transient substrate-protein interactions

What methods are most effective for measuring the ATPase activity of recombinant Shewanella MsbA?

The ATPase activity of MsbA can be measured using several complementary approaches:

MethodPrincipleAdvantagesLimitations
Coupled enzyme assayLinks ATP hydrolysis to NADH oxidationReal-time monitoring, high sensitivityPotential interference from coupling enzymes
Malachite green assayColorimetric detection of released phosphateSimple, cost-effectiveEnd-point assay, lower temporal resolution
Radioactive [γ-32P]ATPDirect measurement of phosphate releaseHighest sensitivityRequires radioactive materials handling
ADP-Glo assayLuminescent detection of ADP productionHigh-throughput compatible, no radioactivityMore expensive reagents

Methodological recommendations: For routine activity measurements, the coupled enzyme assay provides the best balance of sensitivity and convenience. Assay conditions should include appropriate detergents to maintain protein stability and various substrate lipids to assess transport coupling.

How can the lipid transport activity of Shewanella MsbA be reliably quantified?

Quantifying lipid transport activity requires specialized methodologies:

  • Reconstitution of purified MsbA into proteoliposomes with defined lipid composition

  • Preparation of fluorescently labeled lipid A or analogous substrates

  • Measurement of substrate translocation using:

    • Fluorescence quenching assays

    • FRET-based transport assays

    • Mass spectrometry to directly quantify transported lipids

Methodological protocol: Reconstitute purified MsbA in proteoliposomes at protein:lipid ratios of 1:100 to 1:1000. Prepare inside-out vesicles to expose the ATP-binding domains. Initiate transport by adding ATP and measure substrate translocation using fluorescence-based assays with appropriate controls for passive diffusion.

What genetic tools are available for studying MsbA function in Shewanella species?

The Shewanella knowledgebase integrates genomic and experimental data, providing researchers with valuable tools for genetic manipulation and functional studies. For MsbA specifically, researchers can utilize:

  • Genome editing techniques (CRISPR-Cas9) adapted for Shewanella

  • Lambda recombinase (Gateway) cloning systems with existing collections of Shewanella ORFs

  • Bar-coded mutant libraries containing MsbA variants

  • Expression vectors optimized for Shewanella

Methodological approach: When designing genetic studies, researchers should first consult the Shewanella knowledgebase (http://shewanella-knowledgebase.org) to identify existing resources and genomic data. For new mutations, site-directed mutagenesis should target conserved motifs identified through comparative genomic analysis.

How can transcriptomic approaches advance our understanding of MsbA regulation in Shewanella?

Transcriptomic analyses can reveal regulatory networks governing MsbA expression under various environmental conditions. The Shewanella knowledgebase contains extensive microarray data from experiments testing different culture conditions, carbon sources, electron donors/acceptors, and stress conditions. These datasets can be mined to identify co-regulated genes and potential regulators of MsbA expression .

Methodological strategy: Design RNA-seq experiments comparing wild-type and regulatory mutants under conditions that challenge membrane integrity. Integrate transcriptomic data with ChIP-seq to identify direct binding of regulators to the msbA promoter. Correlate expression patterns with physiological measurements of membrane transport.

How can engineered variants of Shewanella MsbA contribute to bioremediation applications?

Shewanella species are valued for their bioremediation potential due to their ability to reduce heavy metals and radionuclides. MsbA, as a membrane transporter, could potentially be engineered to enhance cellular resistance to toxic compounds or to facilitate export of harmful substances. Research should focus on:

  • Identifying MsbA variants with altered substrate specificity

  • Engineering MsbA to increase cellular tolerance to toxic metals

  • Determining if MsbA overexpression affects Shewanella's electron transfer capabilities

Methodological approach: Create a library of MsbA variants through directed evolution and screen for enhanced growth in the presence of heavy metals or other contaminants. Characterize successful variants through transport assays and structural analysis to identify beneficial mutations.

What role might MsbA play in enhancing Shewanella-based microbial fuel cells?

Shewanella species are used in microbial fuel cells for energy generation. MsbA's role in membrane biogenesis could impact the cell's electron transfer capabilities, which are crucial for electricity generation. Research in this area should explore:

  • The relationship between MsbA activity and expression of outer membrane cytochromes

  • How MsbA-mediated lipid transport affects membrane conductivity

  • Effects of MsbA variants on electron transfer efficiency and power output in microbial fuel cells

Methodological protocol: Construct Shewanella strains with controlled MsbA expression levels. Evaluate their performance in microbial fuel cells by measuring current production, power density, and columbic efficiency. Correlate electrical output with membrane composition analysis.

How can systems biology approaches integrate MsbA function into cellular models of Shewanella physiology?

Systems biology offers powerful tools to understand MsbA's role within the broader cellular context:

  • Integrate transcriptomic, proteomic, and metabolomic data from the Shewanella knowledgebase

  • Construct metabolic models incorporating membrane biogenesis pathways

  • Develop kinetic models of MsbA transport coupled to cellular energetics

  • Use multi-omics approaches to predict cellular responses to MsbA perturbation

Methodological strategy: Utilize existing datasets in the Shewanella knowledgebase to build network models. Validate predictions through targeted experiments measuring multiple cellular parameters simultaneously when MsbA function is altered .

What computational methods best predict the impact of mutations on MsbA structure and function?

Predicting mutational effects on MsbA requires sophisticated computational approaches:

  • Molecular dynamics simulations to assess structural stability and conformational changes

  • Free energy calculations to quantify effects on ATP binding and hydrolysis

  • Elastic network models to identify allosteric communication pathways

  • Machine learning approaches trained on existing mutational data from ABC transporters

Methodological considerations: Combine multiple computational approaches and validate predictions experimentally. For example, use molecular dynamics to predict structural changes, then confirm with biochemical assays measuring ATPase activity and transport function of mutant proteins.

What are the major technical hurdles in studying Shewanella MsbA and how might they be overcome?

Research on Shewanella MsbA faces several technical challenges:

  • Membrane protein expression and stability issues

  • Difficulty in obtaining sufficient quantities for structural studies

  • Challenges in reconstituting functional protein in artificial membrane systems

  • Complexity of measuring transport activity with native substrates

Methodological solutions:

  • Employ nanodiscs or amphipols to improve protein stability

  • Develop fluorescent substrate analogs for improved transport assays

  • Utilize advanced microscopy techniques to study MsbA in native membranes

  • Explore cell-free expression systems for improved protein yields

What are the unresolved questions regarding the ATP hydrolysis cycle of MsbA and its coupling to transport?

Despite significant research, several aspects of MsbA function remain unclear:

  • The precise sequence of conformational changes during the transport cycle

  • Coupling mechanism between ATP hydrolysis and substrate translocation

  • Role of lipid environment in modulating transport activity

  • Stoichiometry of ATP hydrolysis per substrate transported

Methodological approach: Time-resolved structural methods, such as time-resolved cryo-EM or single-molecule FRET, should be employed to capture intermediate states in the transport cycle. These should be combined with ATP hydrolysis assays and transport measurements to establish energetic coupling ratios.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.