Recombinant Shewanella sp. Probable intracellular septation protein A (Shewmr7_1515)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. You may use this as a reference point.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
yciB; Shewmr7_1515; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Shewanella sp. (strain MR-7)
Target Names
Shewmr7_1515
Target Protein Sequence
MKQLLDFLPLIIFFAVYKFFDIYIASGALIAATALQLVVTYALYKKLEKMHLITFAMVTV FGTLTLVFHDDAFIKWKVTIIYALFALALGVSQLLNKSILKSMLGKEMKVADNIWAHVTW YWVSFFAICGLVNIYVAFRLPLETWVNFKVFGLTALTLINTVITVFYLYKHLPEDQRKEL K
Uniprot No.

Target Background

Function
This protein plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Shewanella sp. Probable intracellular septation protein A?

The Probable intracellular septation protein A in Shewanella species is structurally homologous to the YciB protein family, which plays a crucial role in cell division processes. Current research suggests this protein is involved in membrane organization during bacterial septation and may contribute to the integrity of the inner membrane during cell division. The protein contains transmembrane domains that anchor it within the bacterial inner membrane, where it interacts with other divisome components. Recent studies indicate it may also participate in stress response mechanisms that help Shewanella species adapt to environmental changes in aquatic niches .

How does the amino acid sequence of this protein compare across different Shewanella species?

Comparative genomic analyses of various Shewanella species reveal that the intracellular septation protein A is relatively conserved, particularly in the transmembrane domains. The protein typically consists of 180-185 amino acids with hydrophobic regions that facilitate membrane insertion. The specific isoform Shewmr7_1515 maintains the characteristic membrane-spanning domains seen in homologs like Shewmr4_1449 (181 amino acids), though slight variations exist in non-conserved loops that may reflect species-specific adaptations. Phylogenetic analysis shows clustering of this protein according to evolutionary relationships within the genus, suggesting its sequence has evolved in parallel with speciation events .

What cellular pathways is this protein involved in?

Based on current research, the probable intracellular septation protein A participates in several interconnected cellular pathways:

  • Cell division and septum formation

  • Membrane organization and maintenance

  • Cell envelope stress response

  • Potential involvement in biofilm formation mechanisms

The protein appears to function as part of larger protein complexes rather than in isolation, with evidence suggesting interactions with peptidoglycan synthesis machinery. In pathogenic Shewanella species like S. algae and S. xiamenensis, this protein may additionally interface with virulence pathways, though direct evidence for this connection requires further investigation .

What are the optimal conditions for recombinant expression of this protein?

The optimal expression conditions for recombinant Shewanella sp. probable intracellular septation protein A involve careful consideration of several parameters:

ParameterRecommended ConditionsNotes
Expression systemE. coli BL21(DE3)Alternative strains like Rosetta may improve expression of rare codons
VectorpET-based with N-terminal His-tagC-terminal tags may interfere with membrane insertion
Induction0.5 mM IPTGHigher concentrations can lead to inclusion body formation
Temperature18-22°C post-inductionLower temperatures reduce aggregation risk
Duration16-18 hoursExtended incubation improves yield without compromising quality
MediaLB with 0.4% glucoseAddition of glucose represses basal expression

This membrane protein requires careful optimization, as overexpression can lead to toxicity and aggregation. Using a low-copy number plasmid and maintaining tight control over expression levels significantly improves yield of properly folded protein .

What purification strategy yields the highest purity and activity for this protein?

The most effective purification strategy employs a multi-step approach tailored to this membrane-associated protein:

  • Initial extraction: Use mild detergent solubilization (0.5-1% n-dodecyl-β-D-maltoside or LDAO) rather than harsh denaturants to preserve native structure.

  • First purification step: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with detergent-containing buffers (typical buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% detergent, 10-250 mM imidazole gradient).

  • Intermediate purification: Size exclusion chromatography to separate protein aggregates and achieve >90% purity.

  • Final polishing: Optional ion exchange chromatography if contaminating proteins remain.

  • Storage buffer optimization: 50 mM Tris/PBS buffer pH 8.0 containing 6% trehalose as cryoprotectant, with detergent maintained at concentrations above CMC.

Following this approach, researchers can achieve >95% purity with retention of structural integrity, as confirmed by circular dichroism and functional assays .

How can researchers overcome challenges in expressing this membrane-associated protein?

Membrane proteins like intracellular septation protein A present unique expression challenges. To overcome these obstacles:

  • Co-express with chaperones: Including chaperone proteins like GroEL/GroES can significantly reduce misfolding and aggregation.

  • Optimize membrane targeting: Ensure proper signal sequence functionality by verifying N-terminal processing.

  • Test multiple detergents: Screen a panel of detergents (DDM, LDAO, CHAPS) at varying concentrations to identify optimal extraction conditions.

  • Consider fusion partners: MBP or SUMO fusion tags can enhance solubility without compromising membrane insertion.

  • Implement limited proteolysis: Identify and remove unstable domains that may cause aggregation.

  • Utilize nanodiscs: For functional studies, reconstitution into nanodiscs provides a more native-like lipid environment.

When employing these strategies, it's essential to validate proper folding using techniques like circular dichroism or limited trypsin digestion rather than relying solely on expression yield as a metric of success .

What structural features distinguish this protein from other septation proteins?

The probable intracellular septation protein A from Shewanella species possesses several distinctive structural features:

  • Transmembrane topology: Contains 4-5 transmembrane helices with a characteristic "YXFFXXXA" motif in the first transmembrane segment.

  • Cytoplasmic domain: A relatively short (20-25 amino acid) cytoplasmic domain rich in charged residues that likely mediates protein-protein interactions.

  • Periplasmic loops: Two periplasmic loops of unequal size, with the larger loop containing conserved aromatic residues.

  • C-terminal motif: A distinctive "FKXXALTL" motif in the C-terminal region that shows high conservation across the Shewanella genus.

Unlike FtsZ-associated septation proteins, this protein lacks nucleotide-binding domains, suggesting it functions primarily as a structural component rather than having enzymatic activity. Its structure also differs from the better-characterized DamX and DedD septation proteins in E. coli, which contain peptidoglycan-binding SPOR domains absent in the Shewanella homolog .

What spectroscopic methods are most informative for characterizing this protein's conformation?

Due to the membrane-associated nature of this protein, specialized spectroscopic approaches yield the most valuable structural information:

MethodApplicationKey Information Obtained
Circular DichroismSecondary structure analysisAlpha-helical content (typically 60-70% for this protein)
FTIR SpectroscopySecondary structure in membraneConfirmation of transmembrane helix insertion
Fluorescence SpectroscopyTertiary structure probingEnvironment of tryptophan residues indicates folding quality
NMR (selective labeling)Residue-specific interactionsIdentification of critical interfacial residues
EPR with site-directed spin labelingTopological mappingOrientation and depth of transmembrane segments
HDX-MSConformational dynamicsIdentification of flexible vs. rigid regions

For most comprehensive characterization, researchers should combine CD spectroscopy for secondary structure verification with fluorescence-based thermal shift assays to assess stability in different detergent/lipid environments. The characteristic alpha-helical signature (double minima at 208 and 222 nm) in CD spectra serves as a quality control benchmark for properly folded protein .

What are the most reliable assays for determining this protein's activity in vitro?

For functional characterization of the probable intracellular septation protein A, several complementary assays provide reliable activity assessment:

  • Liposome binding assays: Measures the protein's ability to associate with model membranes containing bacterial lipid compositions.

  • Cross-linking with divisome components: Identifies specific protein-protein interactions using chemical cross-linkers followed by mass spectrometry.

  • GTPase modulation assay: Tests whether the protein affects FtsZ's GTPase activity, which would suggest a role in regulating Z-ring dynamics.

  • Lipid bilayer electrical conductance: Determines if the protein forms or modulates membrane channels.

  • Peptidoglycan binding assay: Assesses interaction with isolated peptidoglycan using fluorescently labeled protein.

How can researchers effectively study the protein's role in cell division using genetic approaches?

Genetic approaches offer powerful insights into this protein's biological function:

  • Controlled depletion systems: Rather than complete gene deletion, which may be lethal, implement tunable expression systems (tetR-based) to gradually reduce protein levels and observe cellular responses.

  • Fluorescent protein fusions: Create N- or C-terminal fusions with msfGFP or mCherry to track localization during cell cycle progression, with care to verify fusion protein functionality.

  • Site-directed mutagenesis: Generate point mutations in conserved residues to identify critical functional domains through complementation studies.

  • Suppressor screens: Identify genes that, when overexpressed, can compensate for septation protein deficiency, revealing functional pathways.

  • Synthetic lethality analysis: Test for genetic interactions with other division proteins by creating double conditional mutants.

When conducting these studies, researchers must account for potential redundancy in septation functions. Phenotypic analysis should include time-lapse microscopy with membrane and DNA stains to differentiate primary division defects from secondary consequences. Quantification of cell length, division site placement, and cell morphology abnormalities provides robust metrics for functional assessment .

What microscopy techniques are most revealing for studying this protein's localization and dynamics?

Advanced microscopy approaches provide critical insights into the spatial and temporal behavior of septation proteins:

TechniqueApplicationResolutionKey Advantage
Structured Illumination Microscopy (SIM)Protein localization relative to divisome~120 nmCompatible with live-cell imaging
Single-Molecule Localization MicroscopyPrecise protein distribution~20-30 nmReveals clustering and stoichiometry
FRAP (Fluorescence Recovery After Photobleaching)Protein dynamicsN/AMeasures exchange rates at division site
Time-lapse fluorescence microscopyTemporal sequence of localization~250 nmCaptures complete division cycle
Cryo-electron tomographyNative protein context~4-5 nmVisualizes protein in native membrane

For septation proteins, single-color imaging is insufficient; dual-color imaging with an established divisome marker (e.g., FtsZ-mCherry) is essential to interpret localization data correctly. The probable intracellular septation protein A typically shows dynamic localization, appearing at incipient division sites shortly after FtsZ and remaining until daughter cell separation. Quantitative image analysis, including measurement of fluorescence intensity profiles across the division plane, provides objective metrics for comparing wild-type and mutant proteins .

How does this protein vary across different Shewanella species, and what does this reveal about its evolution?

Comparative genomic analysis across the Shewanella genus reveals significant insights about the evolution of the intracellular septation protein A:

  • Core vs. accessory status: The gene encoding this protein belongs to the core genome present in all 144 analyzed Shewanella genomes, indicating its fundamental importance.

  • Sequence conservation pattern: The transmembrane domains show 75-90% sequence identity across species, while periplasmic and cytoplasmic regions display greater variability (40-60% identity).

  • Selective pressure: dN/dS ratio analysis indicates purifying selection on transmembrane regions but neutral or slightly positive selection on exposed loops.

  • Phylogenetic clustering: The protein's phylogeny largely recapitulates species relationships, suggesting vertical inheritance rather than horizontal gene transfer.

  • Environmental adaptation: Slight variations in the protein sequence correlate with environmental niches - clinical isolates (S. algae, S. xiamenensis) share specific amino acid substitutions distinct from environmental isolates.

This evolutionary pattern suggests the protein serves a conserved function in cell division while adapting to specific membrane compositions or interaction partners that may vary between species adapted to different environments .

How does this protein compare functionally to homologs in other bacterial genera?

The probable intracellular septation protein A shares functional characteristics with homologs in diverse bacteria, though with important distinctions:

  • E. coli YciB: The closest characterized homolog (40-45% sequence identity) functions in membrane homeostasis and contributes to cell division, though it appears less essential than in Shewanella.

  • Vibrio homologs: Show 55-60% identity and similar genetic context, suggesting conserved function in these closely related marine bacteria.

  • Pseudomonas homologs: More distant (35% identity) but retain similar membrane topology; associated with stress response rather than primary division functions.

  • Distant homologs in Gram-positive bacteria: Some functional analogy to GpsB proteins, though with different structural organization.

The widespread distribution suggests ancient evolutionary origins, but functional divergence appears common. While core membrane association and divisome interaction are conserved, the precise role may vary from essential division functions in some species to accessory stress-response roles in others. Complementation experiments have demonstrated that the Shewanella protein can partially restore normal morphology in E. coli yciB mutants, confirming some functional conservation despite sequence divergence .

What insights can phylogenetic analysis provide about the acquisition of this protein in different bacterial lineages?

Phylogenetic analysis of the intracellular septation protein across bacterial phyla reveals complex evolutionary dynamics:

  • Ancient origin: The protein's presence across diverse proteobacteria suggests origination before proteobacterial diversification (>2 billion years ago).

  • Vertical inheritance pattern: Within the Shewanella genus, protein phylogeny largely matches whole-genome phylogeny, indicating vertical transmission as the dominant mode of inheritance.

  • Limited horizontal gene transfer: Unlike many membrane proteins in Shewanella that show evidence of HGT, this protein shows little evidence of recent horizontal acquisition between distinct lineages.

  • Co-evolution with interacting partners: Correlation analysis of evolutionary rates with other divisome components suggests co-evolution with specific division proteins (particularly FtsQ and FtsL).

  • Lineage-specific gene loss: Several bacterial groups show patchy distribution, suggesting multiple independent loss events rather than HGT.

These patterns contrast with the extensive horizontal transfer of mobile genetic elements and resistance genes documented in Shewanella. The protein appears to belong to a conserved core of cellular machinery that remains relatively protected from frequent horizontal exchange, likely due to its integration into complex interaction networks that constrain evolutionary flexibility .

How might this protein contribute to virulence in pathogenic Shewanella species?

While primarily involved in cell division, the probable intracellular septation protein may contribute to virulence in pathogenic Shewanella species through several mechanisms:

  • Stress adaptation: The protein appears upregulated under host-associated stress conditions (pH changes, antimicrobial peptides), potentially enhancing survival in hostile host environments.

  • Cell morphology regulation: Proper septation affects cell size and shape, which influences immune recognition and phagocytosis susceptibility.

  • Biofilm formation: Septation defects alter cell surface properties, potentially affecting initial attachment during biofilm development.

  • Coordinated expression with virulence factors: Transcriptomic data from S. algae clinical isolates shows co-regulation of this gene with iron acquisition systems and adhesins during infection-mimicking conditions.

  • Response to membrane-targeting antimicrobials: The protein may participate in membrane remodeling that confers tolerance to host defense peptides.

What experimental approaches can determine if this protein affects antimicrobial resistance?

To investigate potential connections between this septation protein and antimicrobial resistance, researchers should employ these complementary approaches:

  • Susceptibility testing with conditional expression: Compare MIC values for various antimicrobials between wild-type and protein-depleted strains.

  • Membrane permeability assays: Measure uptake of fluorescent dyes (propidium iodide, NPN) to assess membrane integrity changes associated with protein alteration.

  • Peptidoglycan analysis: Characterize changes in cell wall structure using HPLC analysis of muropeptides when protein levels are modulated.

  • Time-kill kinetics: Determine if protein depletion alters killing dynamics rather than just endpoint susceptibility.

  • Resistance development rates: Assess whether protein overexpression affects the rate of development of resistance to clinically relevant antibiotics.

This protein likely influences resistance indirectly through its effects on membrane organization and cell division rather than through direct antibiotic inactivation. Research should focus particularly on β-lactams and membrane-active agents, which target processes connected to septation. Given Shewanella's role as a reservoir for resistance genes like blaOXA-48 and qnrA, understanding how core cellular machinery interfaces with acquired resistance mechanisms has significant clinical relevance .

How does environmental adaptation in Shewanella species affect this protein's function?

Shewanella species inhabit diverse environments ranging from deep-sea sediments to clinical settings, and the septation protein shows adaptations reflecting this ecological diversity:

  • Temperature adaptation: Cold-adapted species (e.g., S. frigidimarina) contain variants with reduced hydrophobicity in certain transmembrane regions, potentially maintaining appropriate membrane fluidity at low temperatures.

  • Pressure responses: Deep-sea isolates show amino acid substitutions that favor protein stability under high-pressure conditions.

  • Salt tolerance correlation: Halotolerant species contain variants with distinctive charged residue distributions in cytoplasmic domains, likely influencing ionic interactions under high-salt conditions.

  • Host-associated adaptations: Clinical isolates share specific substitutions in periplasmic loops that may reflect adaptation to host-associated conditions.

  • Stress response integration: The protein's expression is differentially regulated in response to environmental stressors across species, suggesting adaptation of regulatory networks.

This environmental adaptation parallels the genus-wide patterns observed in the Shewanella mobilome and resistome, where clinical-related lineages show enhanced capacity for horizontal gene acquisition. The probable intracellular septation protein thus represents an interesting case study in how core cellular functions adapt to different ecological niches while maintaining their fundamental role in cell division .

How can researchers leverage this protein for synthetic biology applications?

The unique properties of the probable intracellular septation protein create several opportunities for synthetic biology applications:

  • Controllable cell morphology systems: Engineered variants under inducible control can create bacteria with programmable cell sizes and shapes for specialized applications.

  • Membrane protein expression platforms: The protein's efficient membrane integration machinery could be harnessed to improve production of challenging membrane proteins.

  • Environmental biosensors: Fusion constructs linking environmental response elements to this protein can create bacteria that change morphology in response to specific signals.

  • Minimal cell design: Understanding the essential functions of this protein contributes to rational design of minimal bacterial genomes.

  • Membrane nanodomain engineering: The protein's role in organizing membrane domains could be exploited to create synthetic lipid rafts for localized biochemical reactions.

When developing such applications, researchers must consider the protein's interactions with native cellular machinery. Heterologous expression systems require careful optimization, as improper expression can disrupt host cell division. Rational design approaches based on structural modeling have proven most successful, particularly when combined with directed evolution to fine-tune functionality .

What are the current methodological challenges in studying membrane-associated septation proteins?

Researchers face several persistent challenges when studying proteins like the probable intracellular septation protein A:

  • Structural determination limitations: Traditional crystallography is challenging for membrane proteins; alternatives like cryo-EM require specialized equipment and expertise.

  • Functional reconstitution complexity: Recreating appropriate membrane environments that support native protein function requires extensive optimization.

  • Interaction network elucidation: Identifying transient or weak interactions within the divisome remains technically difficult.

  • Genetic manipulation in non-model organisms: Many Shewanella species lack well-developed genetic tools, complicating in vivo studies.

  • Quantitative activity assays: Lack of enzymatic activity makes functional assessment less straightforward than for catalytic proteins.

  • Environmental relevance gap: Laboratory conditions often poorly mimic the complex environments where Shewanella naturally functions.

To overcome these challenges, successful approaches have combined complementary methods rather than relying on single techniques. For example, low-resolution structural data from SAXS or cryo-EM can be integrated with molecular dynamics simulations and crosslinking data to develop comprehensive structural models. Similarly, functional studies benefit from combining in vitro reconstitution with in vivo genetic approaches .

How might studying this protein contribute to developing new antimicrobial strategies?

Investigation of the probable intracellular septation protein offers several promising avenues for novel antimicrobial development:

The increasing clinical relevance of multidrug-resistant Shewanella infections, particularly involving S. algae and S. xiamenensis, makes this research direction particularly timely. While direct therapeutic applications remain distant, fundamental research on division processes in these emerging pathogens fills an important knowledge gap that could inform future intervention strategies .

What are common pitfalls in recombinant expression and purification of this protein, and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant septation proteins:

ChallengeSolutionValidation Method
Poor expression yieldLower induction temperature (18°C); use C41(DE3) or C43(DE3) strains designed for membrane proteinsSDS-PAGE of whole-cell lysates
Inclusion body formationCo-express with chaperones (GroEL/GroES); add glycerol (5-10%) to growth mediaFractionation analysis of soluble vs. insoluble protein
Impaired protein foldingInclude proper lipid mixtures during purification; avoid harsh detergentsCircular dichroism to confirm α-helical content
Aggregation during purificationMaintain detergent above critical micelle concentration; add 10% glycerol to all buffersDynamic light scattering to assess homogeneity
Poor stability after purificationAdd 6% trehalose as cryoprotectant; avoid repeated freeze-thaw cyclesThermal shift assays to measure stability
Proteolytic degradationAdd protease inhibitor cocktail; purify at 4°C; minimize time between stepsWestern blot to detect degradation products

The most successful purification strategies typically involve careful optimization of detergent type and concentration, as improper detergent selection is the most common cause of protein instability. Screening multiple detergents (DDM, LDAO, CHAPS) at different concentrations often identifies conditions that yield stable, homogeneous protein preparations suitable for downstream analyses .

How can researchers effectively validate protein-protein interactions involving this septation protein?

Validating interactions with membrane-associated septation proteins requires multiple complementary approaches:

  • Bacterial two-hybrid screening: Modified membrane-specific two-hybrid systems can identify potential interaction partners.

  • Co-immunoprecipitation with crosslinking: Chemical crosslinking (DSP, formaldehyde) before cell lysis helps capture transient interactions.

  • Fluorescence resonance energy transfer (FRET): Live-cell FRET with fluorescently tagged proteins provides in vivo evidence for proximity.

  • Surface plasmon resonance (SPR): Quantitative measurement of binding kinetics between purified proteins confirms direct interactions.

  • Bacterial three-hybrid assays: Tests whether interactions require a third protein component.

  • Genetic suppression analysis: Identifies whether overexpression of interaction partners can compensate for septation protein mutations.

For conclusive validation, interactions should be confirmed by at least three independent methods, with priority given to approaches that work in the native cellular environment. When reporting interactions, researchers should specify the experimental conditions, as membrane protein interactions often depend on lipid composition and detergent environment .

What quality control measures ensure reproducible results when working with this protein?

To ensure experimental reproducibility with the probable intracellular septation protein A, implement these quality control measures:

  • Protein quality assessment:

    • SDS-PAGE with Coomassie staining to verify >90% purity

    • Western blot to confirm full-length protein (not degradation products)

    • Circular dichroism to verify proper secondary structure (α-helical content)

    • Mass spectrometry to confirm exact molecular weight and modifications

  • Functional validation:

    • Liposome binding assays to verify membrane association

    • Thermal stability measurements under defined conditions

    • Interaction verification with known binding partners

  • Batch documentation:

    • Record all expression conditions, including strain, media lot, and induction parameters

    • Document complete purification procedure with buffer compositions

    • Measure protein concentration by multiple methods (Bradford, BCA, A280)

    • Store small aliquots with minimal freeze-thaw cycles

  • Experimental controls:

    • Include proper negative controls (non-specific proteins) in interaction studies

    • Use both positive and negative controls in functional assays

    • Verify activity of key reagents before each experiment

Implementation of these measures significantly improves reproducibility between experiments and between laboratories. Particularly important is the verification of proper protein folding, as misfolded membrane proteins can produce misleading results in downstream applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.