Recombinant Shewanella sp. Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Protein Classification and Identification

UbiB from Shewanella species is classified as a probable protein kinase that regulates ubiquinone biosynthesis. The protein belongs to the transferring phosphorus-containing groups enzyme category (EC 2.7.-.-), indicating its role in phosphorylation reactions . Across the Shewanella genus, UbiB maintains a consistent length of 549 amino acids, though with sequence variations between species and strains . The protein has been assigned several identifiers in major databases, including UniProt IDs A1RP80 (Shewanella sp.), Q0HZP9 (Shewanella sp. strain MR-7), and A3D9F4 (Shewanella baltica OS155) .

Amino Acid Sequence Analysis

The primary structure of UbiB is characterized by a full-length sequence of 549 amino acids across different Shewanella species. Sequence analysis reveals conservation of key functional domains despite minor variations between species. For example, the Shewanella sp. variant (UniProt ID: A1RP80) begins with the amino acid sequence "MTLTSIRRGYHVIKTLLQYGLDEVLPPKMTPWYFTLARSSLFWIRNKHKSKP..." while the Shewanella sp. strain MR-7 variant (UniProt ID: Q0HZP9) shows slight variations with "MTLASIRRGYHVIKTLLQYGLDDVLPPKMTPWYFKLARNSLFWIRNKHKGKS..." . These sequence differences may contribute to species-specific functional adaptations while maintaining the core catalytic capabilities.

Role as a Protein Kinase Regulator

The primary function of UbiB appears to be as a protein kinase regulator of UbiI activity, which plays a crucial role in the aerobic biosynthesis of coenzyme Q (ubiquinone) . Ubiquinone is an essential component of the electron transport chain in cellular respiration, making UbiB indirectly critical for energy metabolism in Shewanella species. The protein likely modulates UbiI through phosphorylation, though the exact mechanism and regulation patterns require further investigation.

Interaction Network and Pathway Integration

Protein interaction data from STRING database indicates that UbiB functions within a network of proteins involved in ubiquinone biosynthesis . Notable interaction partners include ubiE (ubiquinone biosynthesis methyltransferase), ubiF (2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase), ubiG (3-demethylubiquinone-9 3-methyltransferase), and other proteins involved in the ubiquinone biosynthetic pathway . These interactions suggest that UbiB functions as part of a coordinated enzymatic complex rather than in isolation, highlighting its integration into the broader metabolic network of Shewanella species.

Significance in Bacterial Metabolism

The ubiquinone biosynthesis pathway in which UbiB participates is crucial for aerobic respiration in bacteria. By regulating UbiI activity, UbiB influences the production of ubiquinone, which serves as an electron carrier in the respiratory chain and contributes to ATP generation . This function makes UbiB an essential component for energy metabolism in Shewanella species, particularly under aerobic conditions.

Expression Systems and Methods

Recombinant UbiB protein from various Shewanella species is typically produced using Escherichia coli expression systems . The protein is commonly expressed with an N-terminal histidine tag (His-tag) to facilitate purification through affinity chromatography techniques. This approach enables efficient isolation of the target protein while maintaining its functional integrity. The expression in E. coli suggests compatibility with standard bacterial expression vectors and protocols, making it accessible for laboratory production.

Quality Control Parameters

Commercial recombinant UbiB preparations typically undergo quality control testing to ensure purity greater than 90% as determined by SDS-PAGE analysis . This high purity standard is essential for research applications where contaminants could interfere with experimental results. Additional quality parameters may include functional assays to verify the protein's enzymatic activity, though specific details of such testing are not consistently provided in product documentation.

Species and Strain Variations

Several commercial variants of recombinant UbiB are available from different Shewanella species and strains. These include Shewanella sp. (UniProt ID: A1RP80), Shewanella sp. strain MR-7 (UniProt ID: Q0HZP9), and Shewanella amazonensis (UniProt ID: A1SAK0) . Each variant offers slightly different amino acid sequences while maintaining the core functional domains necessary for UbiB activity. The availability of multiple species variants provides researchers with options to select the most appropriate form for their specific experimental needs.

Table 1: Comparison of Commercial Recombinant UbiB Variants from Different Shewanella Species

SpeciesCatalog NumberUniProt IDAmino Acid LengthExpression SystemTag
Shewanella sp.RFL3473SFA1RP80549E. coliHis (N-terminal)
Shewanella sp. (strain MR-7)RFL24494SFQ0HZP9549E. coliHis (N-terminal)
Shewanella amazonensisRFL30726SFA1SAK0549E. coliHis (N-terminal)
Shewanella baltica OS155-A3D9F4---

Handling Recommendations

Manufacturers provide specific handling recommendations to maintain protein integrity. These include avoiding repeated freeze-thaw cycles, storing working aliquots at 4°C for up to one week, and using appropriate reconstitution protocols . The addition of glycerol (5-50% final concentration) is recommended for long-term storage to prevent protein denaturation during freezing. These handling precautions are essential for preserving the structural and functional integrity of the recombinant protein.

Biochemical and Enzymatic Studies

Recombinant UbiB serves as a valuable tool for investigating the enzymatic mechanisms of ubiquinone biosynthesis. Researchers can utilize the purified protein to study its kinase regulatory activity, substrate specificity, and interaction with UbiI and other pathway components . Such studies contribute to our understanding of bacterial metabolism and energy production pathways, particularly in the context of aerobic respiration.

Antibody Production and Immunological Research

Recombinant UbiB proteins can serve as antigens for antibody production, enabling the development of detection and visualization tools for studying the expression, localization, and regulation of native UbiB in bacterial systems. Such antibodies facilitate immunological research approaches including Western blotting, immunoprecipitation, and immunofluorescence microscopy, expanding the methodological toolkit for investigating ubiquinone biosynthesis.

Drug Discovery and Biotechnology Applications

As a component of the ubiquinone biosynthetic pathway, UbiB represents a potential target for antimicrobial drug development. Recombinant UbiB enables high-throughput screening of compound libraries to identify inhibitors that could disrupt bacterial energy metabolism . Additionally, understanding UbiB function could contribute to biotechnological applications, particularly those aiming to engineer or optimize ubiquinone production for industrial or pharmaceutical purposes.

Elucidation of Regulatory Mechanisms

Despite its identification as a probable protein kinase regulator, the precise regulatory mechanisms of UbiB remain to be fully characterized. Future research could focus on identifying the specific phosphorylation sites on UbiI that are targeted by UbiB, the conditions that modulate UbiB activity, and the upstream regulators that control UbiB expression and function . Such investigations would enhance our understanding of the regulatory networks governing ubiquinone biosynthesis.

Comparative Analysis Across Bacterial Species

While current research has focused on UbiB from Shewanella species, comparative analysis with homologous proteins from other bacterial genera could provide evolutionary insights and reveal conserved functional domains. Such comparative studies might identify species-specific adaptations in the ubiquinone biosynthetic pathway and inform broader understanding of bacterial metabolism across diverse ecological niches.

Integration with Systems Biology Approaches

Future research could benefit from integrating UbiB studies with systems biology approaches, including metabolomics, proteomics, and computational modeling. These approaches would place UbiB function in the context of broader cellular networks, revealing its connections to other metabolic pathways and its role in bacterial adaptation to environmental changes . Systems-level analysis could also identify potential secondary functions of UbiB beyond its primary role in ubiquinone biosynthesis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; Shewana3_3727; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Shewanella sp. (strain ANA-3)
Target Names
ubiB
Target Protein Sequence
MTLASIRRGYHVIKTLLQYGLDDVLPPKMTPWYFKLARNSLFWIRNKHKGKSGGERLKLA MQELGPVYIKLGQMLSTRRDLLSDEWANELAMLQDKVPPFDGALARQAIEAELKAPIESY FDDFDETPLASASISQVHTATLKSNGKAVVLKVLRPNVETKIQADLLLMSQTAKVIDYLL GEGNRLRPSEVIEDYRVTILGELNLKLEALNAIKLRNNFLDSDALYIPYVYEEFCYPRLM VMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRDNFFHADMHPGNIFISREHP ENPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYIESGWVSEKTDLQAFEQ AIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFPELIYDNLKLGRKLLSS QQQMLDKYLKYQQQAHKSNYLLITSAILLICGTLLFNQDATLWSPYVCLISGAVLWIIGW RSRPKNRKF
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiB protein and what is its role in Shewanella species?

UbiB (Probable ubiquinone biosynthesis protein UbiB) is a protein involved in ubiquinone (Coenzyme Q) biosynthesis in Shewanella species. It likely functions as a protein kinase regulator of UbiI activity which is crucial for aerobic coenzyme Q biosynthesis. In Shewanella oneidensis, UbiB is a 549 amino acid protein with an N-terminal His-tag when recombinantly expressed . The protein belongs to the enzyme classification EC 2.7.-.- (Transferring phosphorus-containing groups), indicating its potential role in phosphorylation reactions . As ubiquinone is essential for cellular respiration and electron transport, UbiB plays a significant role in Shewanella's energy metabolism and potentially its electroactive properties.

How do UbiB proteins from different Shewanella species compare?

UbiB proteins show conservation across Shewanella species but with notable differences. For example, Shewanella oneidensis UbiB (UniProt ID: Q8E9R5) and Shewanella baltica UbiB (UniProt ID: A3D9F4) share significant sequence homology but may have species-specific adaptations . These differences could reflect adaptations to different environmental niches or metabolic requirements. Comparative analysis of UbiB proteins across Shewanella species provides insights into evolutionary adaptations related to ubiquinone biosynthesis and electron transport capabilities.

What expression systems are optimal for recombinant UbiB production?

Escherichia coli has been successfully used as an expression system for recombinant Shewanella oneidensis UbiB. The protein can be expressed with an N-terminal His-tag to facilitate purification . When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli if expression levels are low

  • Inclusion of appropriate purification tags (His-tag has been demonstrated to work effectively)

  • Selection of suitable promoters for controlled expression

  • Optimization of growth conditions (temperature, media composition, induction time)

For difficult-to-express proteins, alternative expression systems such as cell-free systems or yeast expression platforms could be explored, though no specific data on these alternatives for UbiB is available in the current literature.

What is the recommended purification protocol for recombinant His-tagged UbiB?

Based on available data, the following purification protocol is recommended:

  • Express His-tagged UbiB in E. coli

  • Harvest cells and prepare lysate using appropriate buffer systems

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins

  • Consider additional purification steps such as ion exchange or size exclusion chromatography if higher purity is required

  • Assess purity by SDS-PAGE (>90% purity is achievable)

  • Lyophilize the purified protein for long-term storage

The final product should be stored in appropriate buffer conditions (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) to maintain stability .

What are the optimal storage conditions for preserving UbiB activity?

To maintain optimal activity and stability of recombinant UbiB:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default is 50%)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. For long-term storage, maintaining the protein at -80°C in single-use aliquots is recommended.

How can researchers assess the functional integrity of stored UbiB samples?

To verify that stored UbiB samples maintain functional integrity, researchers should:

  • Perform SDS-PAGE analysis to confirm the absence of degradation products

  • Conduct activity assays based on UbiB's putative kinase function

  • Verify protein folding using circular dichroism or fluorescence spectroscopy

  • If antibodies are available, perform Western blotting to confirm the presence of intact protein

These assessments should be conducted periodically for long-term stored samples and before critical experiments to ensure reliable results.

How can UbiB function be studied in the context of Shewanella biofilm formation?

Shewanella species, particularly S. oneidensis, form electroactive biofilms that play crucial roles in electron transfer in microbial electrochemical systems. To study UbiB's role in biofilm formation:

  • Generate UbiB knockout or knockdown strains and compare biofilm formation to wild-type using:

    • Congo red assay to assess the production of extracellular polymeric substances

    • Ruthenium red staining to visualize the biofilm matrix using transmission electron microscopy

    • Hydrophobicity assays to measure cell surface properties using the hexadecane partitioning method

  • Contact angle measurements with water, diiodomethane, and formamide can evaluate biofilm hydrophobicity, which affects attachment and growth

  • Quantify biofilm biomass using the bicinchoninic acid (BCA) protein assay as described in the literature

Biofilm Assessment MethodMeasurement ParameterRelevance to UbiB Function
Congo red assayClearing zones around coloniesIndicates production of extracellular matrix components
Ruthenium red stainingVisualization of cell surface structuresReveals cell envelope properties potentially affected by UbiB
Hydrophobicity assayAffinity percentage to organic phaseMeasures cell surface hydrophobicity changes in UbiB mutants
Contact angle measurementSurface tension with different liquidsQuantifies biofilm hydrophobicity alterations
BCA protein assayProtein content of biofilmQuantifies biomass production differences

What methods can assess UbiB's impact on electron transfer in Shewanella?

As UbiB likely influences ubiquinone biosynthesis, it may significantly impact Shewanella's electron transfer capabilities:

  • Perform electrochemical measurements of wild-type versus UbiB mutant strains in microbial fuel cells

  • Measure output power density, which has been reported to reach up to 3.62 ± 0.06 W m⁻² in engineered Shewanella biofilms

  • Conduct cyclic voltammetry to assess changes in redox properties

  • Quantify ubiquinone levels using HPLC or LC-MS/MS to correlate with electron transfer efficiency

  • Examine extracellular electron transfer rates using soluble electron acceptors

Understanding UbiB's role in electron transfer could potentially lead to engineered strains with enhanced electrochemical properties for microbial electrochemical systems.

What genetic approaches are most effective for studying UbiB function in Shewanella?

To elucidate UbiB function through genetic manipulation:

  • Create precise gene deletions using homologous recombination or CRISPR-Cas9 systems

  • Develop complementation strains expressing wild-type or mutated UbiB variants to verify phenotypes

  • Design site-directed mutagenesis of key residues to identify critical functional domains

  • Construct UbiB-reporter fusions to monitor expression patterns under different conditions

  • Perform transcriptional analysis using RT-qPCR to quantify expression levels in response to environmental stimuli

For advanced studies, genetic suppressor screens can identify interacting genes or pathways that compensate for UbiB deficiency.

How can protein-protein interactions of UbiB be investigated?

To identify UbiB's interaction partners, researchers should consider:

  • Co-immunoprecipitation using anti-His antibodies for His-tagged UbiB

  • Bacterial two-hybrid assays to screen for potential interacting proteins

  • Pull-down assays using purified UbiB as bait

  • Crosslinking mass spectrometry to identify interaction interfaces

  • Blue native PAGE to identify intact protein complexes containing UbiB

These approaches would help elucidate UbiB's position within the ubiquinone biosynthesis pathway and potentially identify novel regulatory interactions.

What mass spectrometry approaches are most suitable for UbiB characterization?

Mass spectrometry provides powerful tools for UbiB characterization:

  • Intact protein MS to verify molecular weight and post-translational modifications

  • Bottom-up proteomics with tryptic digestion for sequence coverage and modification mapping

  • Top-down proteomics for comprehensive characterization of proteoforms

  • Hydrogen-deuterium exchange MS to probe protein dynamics and structure

  • Crosslinking MS to determine UbiB's interaction network

For identifying potential phosphorylation targets of UbiB, phosphoproteomics comparing wild-type and UbiB-deficient strains could reveal substrates affected by UbiB's putative kinase activity.

How can researchers determine the subcellular localization of UbiB in Shewanella?

To establish UbiB's subcellular localization:

  • Perform subcellular fractionation followed by Western blotting or MS detection

  • Create UbiB-fluorescent protein fusions for live-cell imaging

  • Use immunogold labeling with electron microscopy for high-resolution localization

  • Apply proximity labeling approaches (BioID or APEX) to identify neighboring proteins

  • Analyze the protein sequence for localization signals (transmembrane domains are predicted in the C-terminal region )

Understanding UbiB's localization will provide insights into its functional context within ubiquinone biosynthesis and potential membrane association.

What quasi-experimental designs are appropriate for studying UbiB function in complex systems?

When designing experiments to study UbiB function in complex systems like biofilms or microbial communities, researchers should consider:

  • Untreated control group with dependent pretest and posttest samples design:

    • Intervention group: O₁ₐ X O₂ₐ

    • Control group: O₁ᵦ O₂ᵦ
      Where X represents UbiB manipulation (deletion, overexpression, etc.)

  • Repeated-treatment design to assess reversibility of UbiB-related phenotypes:

    • O₁ X O₂ removeX O₃ X O₄

  • One-group pretest-posttest design using a nonequivalent dependent variable to control for confounding factors:

    • (O₁ₐ, O₁ᵦ) X (O₂ₐ, O₂ᵦ)

These experimental designs help establish causal relationships between UbiB function and observed phenotypes while controlling for potential confounding variables.

How should researchers interpret contradictory results in UbiB functional studies?

When faced with contradictory results regarding UbiB function:

  • Carefully evaluate methodological differences between studies (expression systems, purification methods, assay conditions)

  • Consider strain-specific differences (Shewanella oneidensis vs. Shewanella baltica)

  • Assess environmental conditions that might affect UbiB function (aerobic vs. anaerobic, growth phase)

  • Examine potential compensatory mechanisms that might mask phenotypes

  • Verify protein expression and stability in experimental conditions

A systematic approach comparing different methods and conditions can help resolve apparent contradictions and develop a more nuanced understanding of UbiB function.

What are promising approaches for elucidating UbiB's catalytic mechanism?

To determine UbiB's precise catalytic mechanism:

  • Perform structural studies using X-ray crystallography or cryo-EM

  • Conduct in vitro kinase assays with purified UbiB and potential substrates

  • Develop activity-based probes specific for UbiB's active site

  • Implement hydrogen-deuterium exchange mass spectrometry to identify conformational changes upon substrate binding

  • Use computational approaches like molecular dynamics simulations to predict catalytic residues

These approaches would help clarify whether UbiB functions as a kinase and identify its substrates and regulators.

How might UbiB engineering contribute to improved microbial electrochemical systems?

Building on recent advances in Shewanella biofilm engineering, which has achieved power densities up to 3.62 ± 0.06 W m⁻² (39.3-fold higher than wild-type) , UbiB engineering could:

  • Enhance electron transfer efficiency through optimized ubiquinone production

  • Improve biofilm formation and conductivity by modifying UbiB activity

  • Create strains with increased power output for microbial fuel cells

  • Develop biosensors based on electron transfer capacity linked to UbiB function

  • Design synthetic biology approaches that leverage UbiB's role in ubiquinone biosynthesis for novel applications

Strategic UbiB engineering could contribute to next-generation bioelectrochemical systems with significantly improved performance characteristics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.