The amino acid sequence of lgt from Shewanella sp. strain MR-4 (UniProt accession: Q0HG84) and strain ANA-3 (UniProt accession: A0KZP6) reveals high sequence conservation, suggesting evolutionary importance of this enzyme. Both proteins share an identical amino acid sequence: "MALNFPNIDPVIVKFGPFDIFGQTFEPALRWYGFTYLVGFVAAMWLLNRQADRSNGLWSREQVSDLLFYGFLGVILGGRIGYVLFYHFDYFLASPMYLFKISEGGMSFHGGLMGVITAMIYIAWKQKRTFFAVADMVAPVVPIGLGAGRIGNFINGELWGRVTDVPWAMVFPSGGPEPRHPSQLYQFALEGVALFLLLYWFSKRTKKVGAVSGMFLLGYGIFRVIVETVRQPDAQLGLYWGFMTMGQILSVPMVLFGLYLILRPEGKQ" .
The only notable difference between these two strains appears in the C-terminal region, where strain MR-4 contains "ILSVPMVLFGLYLILRPEGKQ" while strain ANA-3 contains "ILSVPMILFGLYLILRPEGKQ" (note the V→I substitution) . This high degree of sequence conservation across different Shewanella strains underscores the evolutionary importance of lgt.
The recombinant lgt protein exhibits specific biochemical characteristics that support its function in the bacterial membrane environment. Table 1 summarizes the key physical and biochemical properties of recombinant Shewanella sp. lgt based on available data.
| Property | Characteristic |
|---|---|
| Molecular Weight | Approximately 30 kDa |
| Enzyme Classification | EC 2.4.99.- (Transferase) |
| Expression Region | Amino acids 1-268 |
| Storage Buffer | Tris-based buffer with 50% glycerol |
| Optimal Storage Temperature | -20°C to -80°C for extended storage |
| Working Temperature | 4°C (for up to one week) |
| Protein Stability | Sensitive to repeated freeze-thaw cycles |
| Membrane Association | Contains hydrophobic transmembrane regions |
The enzyme demonstrates stability in Tris-based buffer with 50% glycerol, which is optimized for maintaining protein structure and function . For research applications, it's recommended to avoid repeated freezing and thawing, with working aliquots stored at 4°C for up to one week to maintain enzymatic activity .
Prolipoprotein diacylglyceryl transferase plays a crucial role in bacterial lipoprotein biogenesis, with significant implications for bacterial cell envelope integrity and function. Understanding its enzymatic mechanism provides insights into potential applications and therapeutic interventions.
The lgt enzyme catalyzes the first essential step in bacterial lipoprotein maturation by transferring a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of prolipoprotein substrates . This reaction involves the formation of a thioether bond and results in the release of glycerol phosphate as a byproduct .
The catalytic reaction can be represented as:
Phosphatidylglycerol + Prolipoprotein → Diacylglyceryl-prolipoprotein + Glycerol phosphate
The specificity of lgt for the conserved cysteine residue in the lipobox motif is critical for its function. Experiments have shown that mutating this cysteine to alanine abolishes the enzymatic reaction, confirming its essential role in the catalytic mechanism .
Lgt-mediated lipid modification of prolipoproteins is fundamental to bacterial membrane biology. The resulting lipoproteins serve diverse functions in Gram-negative bacteria including:
Maintenance of membrane integrity
Nutrient acquisition
Cell signaling processes
Antibiotic resistance mechanisms
Research has demonstrated that genetic depletion of lgt in bacterial systems leads to significant physiological consequences, including permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics . These findings highlight the critical importance of lgt in bacterial survival and pathogenesis.
The availability of recombinant Shewanella sp. lgt has facilitated advanced research into bacterial lipoprotein biosynthesis and the development of novel antimicrobial strategies. Various expression systems and purification techniques have been employed to produce functional recombinant lgt for research applications.
Recombinant Shewanella sp. lgt is typically produced using bacterial expression systems optimized for membrane protein production. The recombinant protein may include affinity tags to facilitate purification, though the specific tag type is often determined during the production process according to experimental requirements .
Recombinant lgt has diverse applications in bacterial physiology research and drug discovery:
Structural Studies: Purified recombinant lgt enables detailed structural analyses through crystallography and other biophysical techniques.
Enzymatic Assays: The recombinant protein serves as a substrate for developing and validating enzymatic assays that measure lgt activity in vitro. These assays typically monitor the release of glycerol phosphate as a reaction byproduct .
Inhibitor Screening: Recombinant lgt provides a platform for screening potential inhibitors through biochemical assays. This application has significant implications for antibacterial drug discovery .
Antibody Production: The purified recombinant protein can be used to generate specific antibodies for immunological detection and localization studies.
Lipoprotein Biogenesis Research: Recombinant lgt facilitates studies on lipoprotein modification and processing in bacterial systems.
The essential role of lgt in bacterial physiology positions it as a potential target for novel antimicrobial strategies. Recent research has identified several aspects of lgt function that might be exploited for therapeutic interventions.
Studies have demonstrated that inhibition of lgt activity can lead to significant disruption of bacterial membrane integrity and function. Key findings supporting lgt as an antibacterial target include:
Lgt depletion in uropathogenic Escherichia coli leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics .
Unlike inhibition of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion, suggesting unique vulnerabilities associated with Lgt inhibition .
The first described Lgt inhibitors (Lgti) have been identified and shown to potently inhibit Lgt biochemical activity in vitro and exhibit bactericidal activity against wild-type Acinetobacter baumannii and E. coli strains .
Recent breakthroughs in Lgt inhibitor development have significant implications for antibacterial drug discovery. Identified inhibitors (including compounds designated G9066, G2823, and G2824) have demonstrated potent inhibition of Lgt biochemical activity with IC₅₀ values ranging from 0.18 μM to 0.93 μM .
| Inhibitor | IC₅₀ Value | Activity Spectrum | Mechanism |
|---|---|---|---|
| G9066 | 0.24 μM | E. coli, A. baumannii | Inhibition of diacylglyceryl transferase activity |
| G2823 | 0.93 μM | E. coli, A. baumannii | Inhibition of diacylglyceryl transferase activity |
| G2824 | 0.18 μM | E. coli, A. baumannii | Inhibition of diacylglyceryl transferase activity |
These inhibitors represent important lead compounds for the development of novel antibacterial agents targeting Lgt function. The high potency and specific mechanism of action position them as promising candidates for further pharmaceutical development .
Analysis of lgt genes across different bacterial species provides insights into the evolutionary history and genetic diversity of this essential enzyme.
While our focus is specifically on Shewanella sp. lgt, it's worth noting that lgt genes are widely distributed across Gram-negative bacteria. The high sequence conservation observed between different Shewanella strains suggests strong evolutionary pressure to maintain lgt function .
The lgt gene (designated as Shewmr4_2862 in strain MR-4 and Shewana3_3040 in strain ANA-3) encodes the full-length protein of 268 amino acids with minimal variation between strains . This conservation extends to the catalytic domains and substrate binding regions, underscoring the enzyme's fundamental importance in bacterial physiology.
In the context of Shewanella species evolution, lateral genetic transfer (LGT) has been documented as an important mechanism for genetic diversity. While specific evidence for LGT of the lgt gene itself is not directly presented in the available search results, the genus Shewanella has been shown to exhibit multiple events of lateral genetic transfer for various genes .
Research has identified 22 integrase gene types in Shewanella species, with 17 being newly described, showing traits of multiple events of lateral genetic transfer . While this information does not specifically address lgt, it highlights the general capacity of Shewanella species for genetic exchange, which could potentially influence the evolution and distribution of essential genes like lgt.
KEGG: shn:Shewana3_3040
STRING: 94122.Shewana3_3040
Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme that catalyzes the first step in the biogenesis of bacterial lipoproteins, which are essential components for bacterial growth and pathogenesis. Specifically, Lgt transfers a diacylglyceryl group from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of prolipoproteins, forming a thioether bond . This modification is crucial for anchoring lipoproteins to the membrane, particularly in Gram-negative bacteria like Shewanella sp.
The reaction catalyzed by Lgt releases glycerol phosphate as a by-product. Due to the racemic nature of the glycerol moiety in phosphatidylglycerol substrates used in biochemical assays, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) can be produced during the enzymatic reaction . This reaction represents the initial step in a three-part process of lipoprotein maturation that is essential for bacterial cell envelope integrity.
While the search results don't provide specific information about Shewanella sp. Lgt genetic variation, comparative genomic analyses of Lgt across Gram-negative bacteria show that the lgt gene is highly conserved in its catalytic domains. Research has demonstrated that Lgt is part of the core genome in most Gram-negative bacteria, with variations primarily occurring in non-catalytic regions.
When studying recombinant Lgt expression, it's important to note that the enzymatic function relies on proper membrane integration, as demonstrated in E. coli studies where Lgt activity is measured by detecting the release of glycerol phosphate during the transfer of diacylglyceryl from phosphatidylglycerol to peptide substrates .
Based on protocols described for other bacterial Lgt proteins, recombinant Shewanella sp. Lgt can be expressed using specialized expression systems designed for membrane proteins. The recommended methodology includes:
Cloning the lgt gene into an expression vector with an appropriate tag (usually His-tag or biotin tag)
Expression in a bacterial host system capable of proper membrane protein folding
Maintaining detergent conditions critical for stability during purification
Using affinity chromatography for initial purification
As demonstrated in research with E. coli Lgt, purification typically requires mild detergents such as n-dodecyl β-D-maltoside (DDM) at concentrations of approximately 0.02% to maintain protein stability and activity . For biochemical assays and crystallography studies, the protein must be maintained in a native-like membrane environment to preserve its structure and function.
Several robust methodologies can be employed to measure Lgt enzymatic activity in vitro:
Glycerol Phosphate Release Assay: This method measures the release of glycerol phosphate (either G1P or G3P) as a by-product of the Lgt reaction. The detection can be coupled to a luciferase-based system for sensitive quantification of enzymatic activity .
Radiolabeled Substrate Incorporation: Using radiolabeled phosphatidylglycerol substrates to track the transfer of diacylglyceryl groups to peptide substrates.
Mass Spectrometry Analysis: Detecting the mass shift in peptide substrates following diacylglyceryl modification.
For reliable results, the peptide substrate should contain the conserved lipobox motif with the essential cysteine residue. In published studies, researchers have used peptide substrates derived from known lipoproteins such as Pal (Pal-IAAC, where C is the conserved cysteine modified by Lgt) . Control experiments should include a mutant peptide with the conserved cysteine mutated to alanine (e.g., Pal-IAA), which would not serve as a substrate for Lgt .
When Lgt is inhibited or depleted, unmodified pro-lipoproteins accumulate in bacterial cells. This accumulation can be detected and characterized using several techniques:
Western Blot Analysis with Fractionation: SDS fractionation can be used to separate peptidoglycan-associated proteins (PAP) from non-peptidoglycan-associated proteins (non-PAP). This approach allows for the identification of different forms of lipoproteins, including:
Specific Antibody Detection: Using antibodies against common lipoproteins like Lpp or Pal to monitor their modification state.
Pulse-Chase Experiments: Tracking the fate of newly synthesized lipoproteins to determine the extent of processing blockage.
Research has shown that Lgt inhibition leads to decreased peptidoglycan association of key lipoproteins such as Lpp and Pal, which is distinct from the effects observed with inhibitors of later steps in lipoprotein maturation .
A comprehensive strategy for identifying and validating Lgt inhibitors should include:
Biochemical Screening Assays: Using purified recombinant Lgt in enzymatic assays to identify compounds that inhibit diacylglyceryl transfer activity.
Affinity Selection Techniques: Methods such as those used to identify macrocyclic peptide inhibitors against E. coli Lgt can be adapted for Shewanella sp. Lgt. This involves:
Validation of On-Target Activity: Multiple approaches should be used to confirm that inhibitors act specifically on Lgt:
Structural Studies: Determining binding modes using X-ray crystallography or cryo-EM to understand inhibitor interactions with Lgt.
| Validation Approach | Expected Outcome for Lgt Inhibitors | Comparison with Other Lipoprotein Pathway Inhibitors |
|---|---|---|
| Pro-lipoprotein accumulation | Accumulation of unmodified pro-Lpp | Different pattern from LspA inhibition (accumulation of DGPLP) |
| Membrane permeability | Increased outer membrane permeabilization | Similar to effects of other lipoprotein pathway inhibitors |
| Cell morphology | Outer membrane blebbing and increased cell size | Specific pattern distinguishable from other inhibitors |
| CRISPRi sensitization | Specifically sensitized by Lgt depletion | Not sensitized by depletion of other pathway components |
| Resistance mechanisms | Deletion of lpp not sufficient for resistance | Different from resistance to LspA or LolCDE inhibitors |
The depletion or inhibition of Lgt has profound effects on bacterial outer membrane integrity:
Membrane Permeabilization: Lgt depletion leads to permeabilization of the outer membrane, as demonstrated in clinical uropathogenic E. coli strains . This permeabilization is due to the failure to properly anchor lipoproteins that maintain membrane structural integrity.
Increased Serum Sensitivity: Bacteria with compromised Lgt function show increased sensitivity to serum killing, likely due to enhanced access of complement proteins to the bacterial surface .
Antibiotic Hypersensitivity: Lgt-depleted bacteria show enhanced sensitivity to multiple classes of antibiotics, particularly those that target cell wall synthesis or that would normally be excluded by an intact outer membrane barrier.
Morphological Changes: Inhibition of Lgt leads to characteristic morphological changes, including outer membrane blebbing and increased cell size . These changes are consistent with the loss of structural integrity in the cell envelope.
Peptidoglycan Association: Lgt inhibition significantly decreases the association of key lipoproteins with peptidoglycan, disrupting the critical linkage between the outer membrane and the cell wall .
These effects distinguish Lgt inhibition from inhibition of other steps in lipoprotein biosynthesis, making it a particularly promising antibacterial target.
Shewanella species are known for their remarkable adaptability to various environmental conditions, including different temperatures, salt concentrations, and redox states. Lipoproteins play crucial roles in these adaptations, and as the enzyme responsible for the first step in lipoprotein maturation, Lgt likely plays a central role in these processes.
While specific data on Shewanella sp. Lgt is limited in the provided search results, research on bacterial adaptation indicates that:
Respiratory Flexibility: Shewanella species can utilize diverse electron acceptors, many of which require specific outer membrane lipoproteins for electron transfer.
Cold Adaptation: Lipoproteins may contribute to membrane fluidity adjustments in response to temperature changes, particularly relevant for Shewanella species isolated from cold environments.
Metal Reduction: Many Shewanella species are known for their ability to reduce metals, a process often mediated by outer membrane proteins that may require proper lipoprotein processing.
Biofilm Formation: Lipoproteins contribute to bacterial adhesion and biofilm formation, important for Shewanella survival in various environments.
Inhibition of different enzymes in the lipoprotein biosynthesis pathway leads to distinct phenotypes and resistance mechanisms:
| Target Enzyme | Function | Effect of Inhibition | Resistance Mechanisms |
|---|---|---|---|
| Lgt | Transfers diacylglyceryl group to pro-lipoprotein | Accumulation of unmodified pro-lipoproteins, decreased PG association | Deletion of lpp not sufficient for resistance |
| LspA (Signal Peptidase II) | Cleaves signal peptide from diacylglyceryl-modified pro-lipoprotein | Accumulation of diacylglyceryl-modified pro-lipoproteins (DGPLP) | Deletion of lpp can confer resistance |
| Lnt (N-acyltransferase) | Adds third acyl chain to N-terminus of cleaved lipoprotein | Accumulation of diacylated mature lipoproteins | Various resistance mechanisms exist |
| LolCDE complex | Transports lipoproteins from inner to outer membrane | Mislocalization of lipoproteins | Specific resistance mutations identified |
A key finding from research is that unlike inhibition of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein, lpp, is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors . This suggests that Lgt inhibition may not be sensitive to one of the most common resistance mechanisms that invalidate inhibitors of downstream steps of bacterial lipoprotein biosynthesis and transport.
Understanding the membrane localization and topology of Lgt is crucial for functional studies. Several techniques can be employed:
Fluorescent Protein Fusions: Creating fusions of Lgt with fluorescent proteins to visualize localization in live cells.
Membrane Fractionation: Separating inner and outer membranes using density gradient centrifugation to determine the membrane localization of Lgt.
Protease Accessibility Assays: Using proteases to digest exposed regions of membrane proteins in intact cells, spheroplasts, or membrane vesicles to determine protein topology.
Cysteine Scanning Mutagenesis: Introducing cysteine residues at various positions and assessing their accessibility to membrane-impermeable sulfhydryl reagents.
Cryo-Electron Microscopy: Visualizing the protein directly in its membrane environment to determine its structural organization.
When expressing recombinant Lgt, it's important to maintain proper detergent conditions, such as 0.02% n-dodecyl β-D-maltoside (DDM), to preserve protein function . Additionally, ensuring that the expression system allows for proper membrane integration is critical for obtaining functionally active protein.
Distinguishing between on-target and off-target effects is critical when evaluating potential Lgt inhibitors. Several complementary approaches should be employed:
Biochemical Assays: Demonstrating direct inhibition of purified Lgt enzymatic activity in vitro, such as measuring the inhibition of glycerol phosphate release in a coupled luciferase reaction .
Phenotypic Comparison with Genetic Depletion: Comparing the phenotypes observed with inhibitor treatment to those seen in strains with controlled depletion of Lgt. Key characteristics to compare include:
CRISPRi Sensitization: Using CRISPRi technology to decrease gene expression of target enzymes and testing for specific sensitization to the inhibitor of interest. For true Lgt inhibitors, cells with decreased lgt expression should be specifically sensitized to the inhibitor compared to cells with normal lgt expression .
Cross-Resistance Testing: Determining if mutants resistant to inhibitors of other lipoprotein biosynthesis steps show cross-resistance to the putative Lgt inhibitor. True Lgt inhibitors should not show cross-resistance with LspA or LolCDE inhibitors .
Western Blot Analysis: Monitoring the accumulation of specific lipoprotein forms (e.g., pro-Lpp) after inhibitor treatment and comparing the pattern to that observed with genetic depletion of Lgt .
This multi-faceted approach provides strong evidence for on-target activity of Lgt inhibitors, even in the absence of resistant mutants.
Recombinant Shewanella sp. Lgt has several potential applications in both biotechnology and therapeutic development:
Antibacterial Drug Development: As a validated antibacterial target, Lgt inhibitors show promise for treating infections caused by multidrug-resistant Gram-negative bacteria. The fact that common resistance mechanisms against other lipoprotein pathway inhibitors are ineffective against Lgt inhibitors makes this target particularly valuable .
Protein Engineering: Understanding the mechanism of Lgt could enable the development of engineered lipoproteins with novel properties for vaccine development or biocatalysis.
Bioelectronic Applications: Given Shewanella's unique electron transfer capabilities, which often involve lipoproteins, engineered Lgt systems could contribute to bioelectronic devices or bioremediation applications.
Structural Biology Platform: Recombinant Lgt could serve as a platform for structural studies of membrane protein complexes, particularly those involved in bacterial cell envelope biogenesis.
Synthetic Biology Tools: Lgt could be incorporated into synthetic biology systems for creating bacteria with novel membrane properties or for displaying functional proteins on cell surfaces.
The development of these applications will require further research into the structural and functional properties of Shewanella sp. Lgt, as well as optimization of expression and purification protocols for obtaining large quantities of active enzyme.
Several methodological advances would significantly enhance our understanding of Lgt substrate specificity:
High-Resolution Structural Studies: Obtaining crystal structures or cryo-EM structures of Lgt in complex with substrate analogs would provide crucial insights into substrate binding and catalysis.
Advanced Mutagenesis Approaches: Combining site-directed mutagenesis with deep mutational scanning could identify residues critical for substrate recognition and catalysis.
Synthetic Substrate Libraries: Developing diverse libraries of synthetic peptide substrates with variations in the lipobox motif to systematically explore substrate preferences.
Computational Modeling: Molecular dynamics simulations of Lgt-substrate interactions could predict structural determinants of specificity that can be experimentally validated.
In Vivo Proteomics: Comparative proteomics of wild-type versus Lgt-depleted bacteria to identify the complete repertoire of Lgt substrates and potential substrate preferences.
These approaches would help address fundamental questions about how Lgt recognizes its substrates and how this recognition might differ between bacterial species, potentially informing the development of species-selective inhibitors.
Integrating Lgt function into systems biology models of bacterial cell envelope biogenesis would provide a more comprehensive understanding of this complex process:
Pathway Integration: Modeling the interconnections between lipoprotein biosynthesis, peptidoglycan synthesis, LPS assembly, and outer membrane protein insertion.
Regulatory Networks: Mapping the transcriptional and post-transcriptional regulatory networks that control lgt expression in response to environmental conditions and stress.
Metabolic Flux Analysis: Quantifying the flow of metabolites through the phospholipid biosynthesis pathway that supplies the diacylglyceryl donor for Lgt.
Temporal Dynamics: Capturing the timing of lipoprotein synthesis, modification, and trafficking in relation to the cell cycle.
Spatial Organization: Modeling the spatial distribution of Lgt activity and its substrates within the bacterial cell membrane.
Such integrated models would enhance our understanding of how bacteria coordinate the various processes involved in cell envelope biogenesis and how these processes might be targeted for antimicrobial development.
Researchers often encounter several challenges when working with recombinant Lgt:
| Challenge | Possible Solution |
|---|---|
| Low expression levels | Optimize codon usage for expression host; use specialized expression strains; consider fusion tags that enhance expression |
| Protein aggregation | Include appropriate detergents (e.g., 0.02% DDM) throughout purification; avoid freeze-thaw cycles; maintain membrane-like environment |
| Loss of activity during purification | Minimize time between cell lysis and final purification; include phospholipids in purification buffers; avoid harsh detergents |
| Difficulty in activity assays | Ensure peptide substrates contain proper lipobox motif; validate assay with known controls; consider using multiple detection methods |
| Protein instability | Optimize buffer conditions (pH, salt concentration); consider adding glycerol or specific lipids; maintain cold temperatures throughout handling |
When designing expression constructs for Lgt, it's important to consider that this is a membrane protein with multiple transmembrane domains. Expression systems that have been successful for E. coli Lgt include biotinylated constructs expressed in the presence of mild detergents like n-dodecyl β-D-maltoside (DDM) .
Enzymatic activity assays for Lgt can show significant variability. Here are methodological approaches to address this issue:
Standardize Substrate Preparation: Ensure consistent preparation of both phosphatidylglycerol and peptide substrates. For peptide substrates, synthetic peptides derived from known lipoproteins (e.g., Pal-IAAC) with the conserved cysteine residue are recommended .
Include Proper Controls: Always include positive controls (known active Lgt preparations) and negative controls (heat-inactivated enzyme, substrate with mutated cysteine like Pal-IAA) .
Optimize Reaction Conditions: Systematically optimize buffer components, pH, temperature, and detergent concentrations for maximum activity and reproducibility.
Use Multiple Detection Methods: Validate results using different detection methods, such as the glycerol phosphate release assay coupled to luciferase, radiolabeled substrates, or mass spectrometry .
Address Enzyme Stability: Monitor enzyme stability over time and at different temperatures to ensure that observed variability is not due to enzyme degradation.
By implementing these methodological improvements, researchers can significantly reduce variability in Lgt enzymatic activity assays and obtain more reliable and reproducible results.