Recombinant Shewanella sp. Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag type, please inform us; we will prioritize fulfilling your request.
Synonyms
htpX; Shewana3_2512; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Shewanella sp. (strain ANA-3)
Target Names
htpX
Target Protein Sequence
MKRIFLLIATNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDSTERWLLDTVARQAQQAGIKMPEVAIYQSPEMNAFATGPSKDNSLVAV STGLLYGMSQDEVEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKHKMIAAL ERLRQGPESSAMPAQMSAFGINGKRSMAELMMSHPPLEKRIAALQTR
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protease HtpX and what is its role in bacterial physiology?

Protease HtpX is an M48 family zinc metalloproteinase located in the cytoplasmic membrane of bacteria, including Shewanella species . As its alternative name "Heat shock protein HtpX" suggests, it is involved in the heat shock response . The protein contains a characteristic zinc-binding motif HEXXH (where X represents any amino acid), with the glutamic acid residue serving as a catalytic site .

HtpX plays a crucial role in membrane protein quality control, eliminating malfolded and/or misassembled membrane proteins that could disturb the structure and function of biological membranes . This proteolytic quality control is essential for maintaining normal cellular activities and stress responses.

How is the htpX gene regulated in bacterial systems?

The regulation of htpX varies across bacterial species. In Bacillus subtilis, the htpX gene was initially reported to be under dual negative control by the Rok repressor and YkrK, a novel type of transcriptional regulator, though recent research has questioned some aspects of this model .

In Shewanella species, the htpX gene is upregulated during heat shock response, alongside other heat shock proteins and chaperones . This upregulation is part of a broader transcriptional response involving approximately 15% of the predicted S. oneidensis genes following a shift to elevated temperature (42°C) .

In response to aminoglycoside exposure, upregulation of htpX has been observed in Stenotrophomonas maltophilia, suggesting its role in stress response extends beyond heat shock .

What are the optimal conditions for expressing and purifying recombinant HtpX?

For successful expression and purification of recombinant Shewanella HtpX, researchers should consider the following approach:

Expression System:

  • Use E. coli as an expression host with a T7 promoter-based expression system (e.g., pET vectors)

  • For studies requiring expression in Shewanella, the synthetic plasmid toolkit for S. oneidensis MR-1 described by Li et al. can be utilized

Storage and Handling:

  • Store purified protein in Tris-based buffer with 50% glycerol

  • Maintain at -20°C for short-term storage, or -80°C for extended storage

  • Avoid repeated freezing and thawing

  • Store working aliquots at 4°C for up to one week

Purification Tags:

  • His-tag systems work well for HtpX purification, with options including His6 or His10 tags

  • When working with the full protein, consider that HtpX is an integral membrane protein, requiring detergent-based extraction methods

How can I design an in vivo assay to measure HtpX protease activity?

Designing an in vivo assay for HtpX activity requires a model substrate that allows sensitive detection. Based on work with E. coli HtpX, the following approach is recommended:

  • Construct a model substrate: Design a fusion protein containing domains that will be cleaved by HtpX. For example, the XMS1 (HtpX Model Substrate 1) approach used for E. coli HtpX can be adapted for Shewanella HtpX .

  • Include reporter proteins: Incorporate easily detectable reporter proteins like GFP (green fluorescent protein) or msfGFP (monomeric superfolder GFP) into your substrate design to monitor cleavage products .

  • Detection method: Use Western blotting with appropriate antibodies to detect the full-length substrate (XMS1-FL) and cleaved fragments (CL-C and CL-N) .

  • Quantification: Implement a semiquantitative measurement by comparing the relative intensities of bands corresponding to intact and cleaved substrates.

  • Controls: Include both positive controls (wild-type HtpX) and negative controls (catalytically inactive HtpX, such as an E156A mutant) .

What genetic manipulation techniques are most effective for htpX gene studies in Shewanella?

For genetic manipulation of htpX in Shewanella species, several effective approaches are available:

Gene Deletion:

  • Create a deletion construct by amplifying regions upstream and downstream of htpX

  • Insert an antibiotic resistance marker (e.g., kanamycin resistance gene) between these regions

  • Clone the construct into a suicide vector (e.g., pMAD)

  • Introduce the construct via conjugation for homologous recombination

Plasmid-Based Expression:
Utilize the synthetic plasmid toolkit developed for S. oneidensis MR-1, which includes:

  • Various promoters with different strengths (constitutive and inducible)

  • Multiple replicons with different copy numbers (ColE, p15A, pSC101, pBBR1)

  • Antibiotic resistance markers for selection

  • RK2 origin of transfer (oriT) for conjugation-based transfer

Conjugation Protocol:

  • Transform your plasmid into E. coli WM3064 (a DAP auxotroph with RP4 Tra function)

  • Mix donor E. coli cells with recipient Shewanella cells

  • Incubate in LB medium containing DAP

  • Plate on selective media without DAP to select for Shewanella transformants

The choice of promoter and replicon significantly affects expression levels. ColE replicon provides the highest copy number (54 copies per cell), followed by pSC101 (40), p15A (33), and pBBR1 (23) .

How does HtpX contribute to antibiotic resistance mechanisms?

HtpX plays a significant role in intrinsic aminoglycoside resistance in certain bacteria. Research on Stenotrophomonas maltophilia has revealed:

  • Upregulation in response to antibiotics: The htpX gene is upregulated in response to kanamycin exposure .

  • Direct impact on resistance: Inactivation of htpX significantly compromises intrinsic aminoglycoside resistance (2- to 16-fold reduction in MICs) .

  • Synergistic effects: When both htpX and clpA are inactivated, there is a substantial decrease in aminoglycoside resistance, suggesting these proteases work through complementary mechanisms .

  • Specificity to certain antibiotics: The effects are specific to aminoglycosides that cause misreading during translation. No change in susceptibility is observed for spectinomycin, which causes translational blockage without misreading .

  • Potential as therapeutic targets: HtpX and ClpA have been identified as potential aminoglycoside adjuvant targets for treatment of resistant bacterial infections .

This research suggests that HtpX likely participates in clearing misfolded proteins that accumulate due to aminoglycoside-induced mistranslation, thereby helping bacteria tolerate these antibiotics.

How can mutagenesis studies reveal the functional domains of HtpX?

Mutagenesis studies are crucial for understanding the structure-function relationship of HtpX. Key approaches include:

Site-Directed Mutagenesis of Conserved Residues:

  • Target the HEXXH zinc-binding motif, particularly the glutamic acid residue (E156 in B. subtilis HtpX) which is predicted to be catalytic .

  • Use primer-based PCR methods for site-directed mutagenesis, as demonstrated in the construction of the E156A mutant .

Mutant Phenotype Analysis:
Measure the effect of mutations on:

  • Protease activity using the in vivo cleavage assay

  • Cellular resistance to stress conditions (e.g., heat shock, aminoglycoside exposure)

  • Membrane protein quality control

MutationRegionExpected EffectAssay Method
E156A (or equivalent)Catalytic siteLoss of protease activityIn vivo substrate cleavage
H155A/H159AZinc-binding motifImpaired metal coordinationIn vivo substrate cleavage
Mutations in transmembrane segmentsMembrane anchoringAltered localizationMembrane fractionation
C-terminal domain mutationsSubstrate recognitionSubstrate specificity changesVaried substrate panel testing

Results from E. coli HtpX studies have shown that mutations in conserved regions lead to decreased protease activity as measured by reduced cleavage of the substrate protein .

What is the relationship between HtpX and the bacterial stress response network?

HtpX is integrated into a broader network of stress response mechanisms in bacteria:

  • Heat Shock Response: In S. oneidensis, approximately 15% of the predicted genes are significantly up- or down-regulated following shift to heat shock temperature (42°C). HtpX is among the genes that are highly and transiently induced during this response .

  • Coordination with Other Proteases: HtpX functions alongside other proteases like ClpA, ClpP, and ClpS. In S. maltophilia, these proteases show coordinated upregulation in response to aminoglycoside exposure .

  • Membrane Protein Quality Control: As part of the quality control system, HtpX eliminates malfolded and misassembled membrane proteins that could compromise membrane integrity and function .

  • Interaction with the MreB Cytoskeleton: In B. subtilis, HtpX has been proposed to be associated with the MreB cytoskeleton, suggesting a potential role in coordinating proteolysis with cell shape maintenance .

  • Metabolic Adaptations: Heat stress response in Shewanella involves not only chaperones and heat shock proteins but also enzymes in glycolysis and the pentose cycle, suggesting HtpX functions within a broader metabolic adaptation network .

Understanding these interactions is essential for developing a comprehensive model of how bacteria adapt to environmental stresses and how these mechanisms might be targeted for antimicrobial development.

Comparative Studies and Evolution

Shewanella species are known for their extracellular electron transfer (EET) capabilities, making them important model organisms for bioremediation studies. Recombinant HtpX can be used to investigate the relationship between protein quality control and EET through several approaches:

  • Expression System Selection: Use the plasmid toolkit developed for S. oneidensis MR-1 to achieve controlled expression of HtpX. This toolkit allows fine-tuning of gene expression through various promoters and replicons with different copy numbers .

  • Experimental Design: Express HtpX at different levels in Shewanella strains and measure EET efficiency using:

    • Tungsten trioxide (WO₃) reduction assays

    • Microbial fuel cell (MFC) measurements

    • Electrochemical techniques

  • Integration with MtrCAB Studies: The MtrCAB porin-cytochrome complex is crucial for EET in Shewanella. Studies have shown that expression of this complex at moderate levels significantly improves EET efficiency . Investigating potential interactions between HtpX and components of the MtrCAB complex could reveal regulatory mechanisms.

  • Stress Response Connection: Since HtpX is upregulated during heat shock, examining how temperature stress affects EET efficiency in wild-type versus htpX mutant strains could reveal connections between stress response and electron transfer capabilities .

  • Membrane Integrity Analysis: As HtpX is involved in membrane protein quality control, assess how its overexpression or deletion affects membrane integrity and composition, which are crucial for EET functions .

This research direction could provide insights into how protein quality control systems influence the unique respiratory capabilities of Shewanella species.

What are the emerging technologies for studying HtpX interactions with other cellular components?

Several cutting-edge technologies show promise for advancing our understanding of HtpX interactions:

  • Cryo-Electron Microscopy (Cryo-EM): This technique can reveal the 3D structure of HtpX in its native membrane environment, providing insights into how it interacts with substrates and other membrane components.

  • Proximity-Dependent Biotinylation (BioID/TurboID): By fusing HtpX to a biotin ligase, researchers can identify proteins that are in close proximity to HtpX in vivo, potentially revealing interaction partners and substrates.

  • Cross-Linking Mass Spectrometry (XL-MS): This approach can capture transient interactions between HtpX and its substrates or regulatory partners, providing a snapshot of the protein's interaction network.

  • Single-Molecule Tracking: Using fluorescently labeled HtpX, researchers can track its movement and localization within the membrane in real-time, potentially revealing functional microdomains.

  • Native Mass Spectrometry: This technique allows for the analysis of intact membrane protein complexes, potentially revealing how HtpX associates with other components in multiprotein assemblies.

  • Artificial Intelligence Prediction Models: Machine learning approaches can predict potential substrates and interaction partners based on sequence and structural features, guiding experimental design.

These technologies, used in combination, could significantly advance our understanding of how HtpX functions within the cellular context and how it contributes to bacterial stress responses and antibiotic resistance.

How might HtpX research contribute to novel antimicrobial strategies?

Research on HtpX holds promise for developing new antimicrobial approaches:

  • Adjuvant Therapy: HtpX inhibitors could serve as adjuvants to enhance the efficacy of existing aminoglycosides against resistant bacteria. Studies have shown that inactivation of htpX significantly increases susceptibility to aminoglycosides .

  • Targeting Stress Response Systems: As part of the bacterial stress response network, HtpX is crucial for adaptation to environmental challenges. Inhibiting HtpX could potentially compromise bacterial survival under stress conditions encountered during infection.

  • Membrane Destabilization: Since HtpX is involved in membrane protein quality control, its inhibition could lead to accumulation of misfolded membrane proteins, potentially destabilizing the bacterial membrane and increasing susceptibility to other antimicrobials.

  • Species-Specific Approaches: The differences in HtpX function and regulation across bacterial species offer opportunities for developing targeted antimicrobial strategies that exploit species-specific vulnerabilities.

  • Combination Therapy Design: Understanding the network of interactions between HtpX and other stress response proteins (e.g., ClpA) could inform the design of combination therapies that target multiple components of the stress response system simultaneously for synergistic effects .

These approaches could help address the growing challenge of antimicrobial resistance by targeting bacterial stress response systems rather than conventional growth pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.