Recombinant Shewanella sp. UPF0114 protein Sputw3181_3501 (Sputw3181_3501)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
The specific tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
Sputw3181_3501; UPF0114 protein Sputw3181_3501
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Shewanella sp. (strain W3-18-1)
Target Names
Sputw3181_3501
Target Protein Sequence
MEKIFERLMYASRWIMAPIYLGLSLVLLGLGIKFFQEIFHVLPIIFEMREVDLVLVTLSL
IDITLVGGLIVMVMFSGYENFVSQLDVGEDSEKLSWLGKLDSGSLKNKVAASIVAISSIH
LLKIFMNVENISNDKIMWYLLIHITFVLSAFAMGYLDKITRK
Uniprot No.
Target Background
Database Links
KEGG: shw:Sputw3181_3501
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
