Recombinant Shewanella sp. UPF0761 membrane protein Shewmr4_0316 (Shewmr4_0316)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Shewmr4_0316; UPF0761 membrane protein Shewmr4_0316
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Shewanella sp. (strain MR-4)
Target Names
Shewmr4_0316
Target Protein Sequence
MTKKIELAQIQVLFLGIWRFLLHLRQRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLS AFPVFKGIRGQIEAFVYENFLPAAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISA IDKSLNNIWRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATSYVVSLKLFEGDALSGVM PLFIERLPLFFSVAAFLLLYMVVPNQKVKFWHALLGAVVAALLFELGKKGFALYVTKFPS YEAIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEYLDYESSSDINETNLDGQPLAAQ DTPAAQPETTSGQSTQVLETTGELAATAPQSTTLDKP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella sp. UPF0761 membrane protein Shewmr4_0316?

Shewmr4_0316 is a membrane protein belonging to the UPF0761 family (Uncharacterized Protein Family) found in Shewanella species. As a membrane-associated protein, it is likely embedded within the bacterial cell membrane and may play roles in processes such as transport, signaling, or maintaining membrane integrity. The UPF designation indicates that its precise biological function remains to be fully characterized through experimental approaches . Shewanella species inhabit diverse aquatic environments including marine and freshwater ecosystems, with some strains having adapted to specific niches such as symbiotic relationships with marine sponges .

The protein is primarily studied in recombinant form for research purposes, which allows for controlled expression and purification to facilitate functional and structural studies. Given that Shewanella species demonstrate remarkable respiratory versatility and unique adaptations to their environments, membrane proteins like Shewmr4_0316 may contribute to these specialized metabolic capabilities or ecological interactions.

How is the gene encoding Shewmr4_0316 characterized in genomic studies?

Genomic characterization of the gene encoding Shewmr4_0316 typically involves several complementary approaches. First, researchers examine its genomic context - analyzing neighboring genes and potential operon structures that might indicate functional relationships. This contextual analysis can provide clues about the protein's biological role, particularly important for proteins of unknown function like UPF0761 family members .

Comparative genomic analyses across different Shewanella strains help determine the conservation level of this gene, which correlates with its functional importance. Recent genomic studies of Shewanella species have revealed distinctive genomic features in strains isolated from different ecological niches. For example, sponge-associated Shewanella strains show evidence of genomic adaptations including specialized secretion systems and enrichment of ankyrin-repeat containing proteins (ANKs) that mediate host interactions .

Expression profile analysis under different environmental conditions provides insights into when and where the protein functions. Researchers typically use RNA-seq or quantitative PCR to measure gene expression levels across various growth conditions, stressors, or developmental stages, helping to connect the gene to specific biological processes.

What are typical structural features of membrane proteins like Shewmr4_0316?

While specific structural information about Shewmr4_0316 is limited in available research, membrane proteins typically share several characteristic structural features. These proteins contain hydrophobic transmembrane domains that anchor them within the lipid bilayer, with the number and arrangement of these domains defining their topology .

Structural analysis of membrane proteins involves predicting transmembrane helices using computational tools such as TMHMM or TOPCONS. The protein likely contains both membrane-spanning regions and soluble domains that extend into either the cytoplasm or extracellular space. These soluble domains often mediate interactions with other cellular components or perform catalytic functions.

Specialized motifs within the sequence may indicate functional properties - for example, binding sites for cofactors, ATP, or other molecules. Post-translational modification sites, if present, could suggest regulatory mechanisms controlling the protein's activity or localization. In Shewanella species specifically, membrane proteins involved in host interactions often contain specialized domains for adhesion or immune evasion .

The three-dimensional structure would ideally be determined through X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy, though these techniques present significant challenges for membrane proteins due to their hydrophobic nature.

What expression systems are recommended for producing recombinant Shewmr4_0316?

Membrane protein expression presents unique challenges compared to soluble proteins, requiring careful selection of expression systems and optimization strategies. For Shewmr4_0316, researchers should consider several options:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coli C41/C43Specialized for membrane proteinsVariable yieldsLower temperature (16-20°C), reduced inducer
E. coli Lemo21Tunable expression levelAdditional antibiotic requiredOptimize rhamnose concentration
Pichia pastorisPost-translational modificationsLonger production timeMethanol induction optimization
Cell-free systemsEliminates toxicity issuesHigher costSupplement with lipids/detergents

For bacterial membrane proteins like Shewmr4_0316, E. coli strains specifically engineered for membrane protein expression (such as C41/C43 or Lemo21) often provide good starting points. Given that Shewanella is a Gram-negative bacterium, E. coli systems may provide appropriate membrane environments for proper folding .

Vector design considerations include adding fusion partners to improve folding (MBP, SUMO), affinity tags for purification (His6, Strep-tag), and appropriate promoters for controlled expression. For challenging membrane proteins, codon optimization based on the expression host can improve translation efficiency. Temperature optimization is crucial, with lower temperatures (16-20°C) generally favoring proper membrane protein folding over rapid expression.

What purification strategies are effective for Shewmr4_0316?

Purification of membrane proteins like Shewmr4_0316 requires specialized approaches to maintain protein stability and function throughout the process:

  • Membrane preparation: After cell lysis (via sonication, French press, or enzymatic methods), differential centrifugation is used to isolate membrane fractions containing the target protein. Multiple washing steps help remove peripheral proteins that are loosely associated with membranes.

  • Solubilization screening: This critical step involves testing multiple detergents to extract the protein from membranes while maintaining its native fold. A systematic screen of detergents typically includes:

    • Mild detergents (DDM, LMNG, OG)

    • Zwitterionic detergents (LDAO, Fos-choline)

    • Newer amphipathic agents (SMALPs, amphipols)

  • Chromatography strategy: Most protocols employ a multi-step approach, beginning with affinity chromatography (leveraging tags added to the recombinant protein), followed by ion exchange chromatography and size exclusion chromatography for additional purity.

  • Quality assessment: SDS-PAGE, western blotting, mass spectrometry, and circular dichroism provide crucial information about purity, identity, and proper folding of the purified protein.

Throughout purification, maintaining an appropriate detergent concentration above its critical micelle concentration is essential to prevent protein aggregation. Given the challenges of membrane protein purification, pilot experiments using small-scale preparations help identify optimal conditions before scaling up to larger volumes.

How should researchers design experiments to characterize the function of Shewmr4_0316?

Characterizing the function of uncharacterized membrane proteins like Shewmr4_0316 requires a multi-faceted experimental approach:

  • Bioinformatic prediction: Begin with computational analyses to predict potential functions based on:

    • Sequence homology with characterized proteins

    • Domain architecture and conserved motifs

    • Structural modeling and comparison

    • Genomic context analysis (neighboring genes)

  • Gene knockout/knockdown studies: Generate deletion mutants or use RNA interference to assess phenotypic changes when the protein is absent or reduced. Key phenotypes to assess include:

    • Growth rates under various conditions

    • Membrane integrity and permeability

    • Resistance to environmental stressors

    • Biofilm formation capability

    • Host interaction phenotypes (particularly relevant for Shewanella)

  • Localization studies: Confirm membrane localization and specific distribution within the cell using:

    • Fluorescent protein fusions

    • Immunogold electron microscopy

    • Subcellular fractionation with western blotting

  • Protein-protein interaction identification: Discover interaction partners that may indicate function:

    • Pull-down assays with tagged protein

    • Bacterial two-hybrid systems

    • Cross-linking followed by mass spectrometry

    • Co-immunoprecipitation from native Shewanella

  • Functional assays: Based on predictions, design specific biochemical tests:

    • Transport assays if a transporter role is suspected

    • Enzymatic activity measurements

    • Binding studies with potential ligands

    • Electrophysiology for channel proteins

For Shewanella membrane proteins, specific attention to potential roles in host interaction (given the importance of secretion systems in sponge-associated strains) or respiratory versatility (a hallmark of this genus) may prove particularly insightful .

What controls are essential in studies involving Shewmr4_0316?

Robust experimental design for membrane protein research requires carefully selected controls to ensure valid and interpretable results:

  • Expression controls: These verify that the protein is correctly produced:

    • Western blotting of whole-cell lysates

    • Comparison of induced vs. non-induced samples

    • Membrane fraction analysis to confirm proper localization

    • Mass spectrometry to verify protein identity

  • Negative controls: These establish baselines and identify non-specific effects:

    • Empty vector expressions processed identically

    • Unrelated membrane protein with similar properties

    • Inactive mutants (site-directed mutagenesis of predicted functional residues)

    • Heat-denatured samples to distinguish structure-dependent effects

  • Positive controls: These validate that experimental systems are functioning properly:

    • Well-characterized membrane protein from Shewanella

    • Known interaction partners if available

    • Commercial standards for activity assays

  • System-specific controls: These address artifacts from experimental systems:

    • Multiple expression host strains to rule out host-specific effects

    • Different fusion tags to ensure tag doesn't drive observed effects

    • Detergent-only controls in binding/activity assays

  • Technical controls: These ensure experimental consistency:

    • Multiple biological and technical replicates

    • Inter-day reproducibility assessments

    • Concentration gradients to establish dose-dependence

    • Time-course measurements to capture dynamics

In Shewanella research specifically, comparative controls with proteins from both free-living and host-associated strains can help identify adaptations related to different ecological niches, as genomic studies have revealed significant differences between these groups .

How can researchers address protein misfolding issues when expressing Shewmr4_0316?

Membrane protein misfolding represents one of the most significant challenges in recombinant protein expression. For Shewmr4_0316, researchers can implement several strategies to improve proper folding:

  • Expression optimization:

    • Reduce expression rate through lower temperatures (16-20°C)

    • Use weaker promoters or tunable expression systems

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Add chemical chaperones to growth media (glycerol, DMSO at low concentrations)

    • Supplement media with specific lipids that might aid folding

  • Construct engineering:

    • Create fusion proteins with well-folded soluble domains

    • Test truncated constructs removing problematic regions

    • Introduce stabilizing mutations based on computational prediction

    • Try homologs from related Shewanella species which might express better

  • Solubilization and refolding:

    • Screen detergent panels systematically (ranging from harsh to mild)

    • Attempt in vitro refolding from inclusion bodies

    • Use lipid nanodiscs or native nanodiscs to provide native-like environments

    • Employ bicelles or amphipols as alternative membrane mimetics

  • Validation of proper folding:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to detect compactly folded domains

    • Activity assays if function is known or predicted

For Shewanella proteins specifically, considering the native environment conditions may be helpful - some Shewanella species are psychrophilic (cold-adapted), suggesting that expression at reduced temperatures might better reflect their native folding conditions .

What approaches can identify protein-protein interactions involving Shewmr4_0316?

Identifying interaction partners is crucial for understanding membrane protein function. For Shewmr4_0316, several complementary approaches can be employed:

  • In vivo approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins (BACTH)

    • Split-ubiquitin systems specifically designed for membrane protein interactions

    • Proximity labeling (BioID, APEX) to identify proteins in close proximity

    • In vivo crosslinking followed by pulldown and mass spectrometry

  • In vitro approaches:

    • Co-immunoprecipitation with detergent-solubilized membranes

    • Pull-down assays using purified protein as bait

    • Surface plasmon resonance with purified components

    • Microscale thermophoresis for quantitative binding parameters

  • Computational prediction:

    • Structural docking simulations

    • Co-evolution analysis to identify residues that evolve together

    • Genomic context methods (gene neighborhood, phylogenetic profiling)

    • Literature-based relationship extraction

Given the findings about Shewanella species' genomic features in search result , particularly important interaction partners to investigate would include:

  • Components of secretion systems (T3SS, T4SS, T6SS) which are prominent in sponge-associated Shewanella strains

  • Ankyrin-repeat containing proteins (ANKs) which are abundant in symbiotic Shewanella and mediate host interactions

  • Proteins encoded in genomic islands, which may contribute to adaptive functions

Validation of identified interactions should include reciprocal experiments, competition assays to test specificity, and mutational analysis of predicted interaction interfaces.

How should contradictory results in Shewmr4_0316 studies be approached?

When faced with contradictory results in membrane protein research, a systematic troubleshooting and reconciliation approach is necessary:

  • Verify experimental foundations:

    • Confirm protein identity through mass spectrometry or sequencing

    • Assess protein integrity via SDS-PAGE and western blotting

    • Validate proper folding through structural or functional assays

    • Examine expression system differences that might affect results

  • Investigate methodological variations:

    • Compare detergent types/concentrations across studies

    • Analyze buffer components (pH, salt concentration, additives)

    • Assess temperature and other environmental conditions

    • Consider differences in detection methods/sensitivities

  • Biological explanations to consider:

    • Potential for multiple functional states or conformations

    • Context-dependent activity influenced by lipid environment

    • Post-translational modifications affecting function

    • Differential interactions with other cellular components

  • Resolution strategies:

    • Design orthogonal assays testing the same function through different approaches

    • Perform side-by-side comparisons under identical conditions

    • Collaborate with other laboratories to compare techniques

    • Consider intermediate hypotheses that accommodate seemingly contradictory findings

For Shewanella proteins specifically, contradictions might arise from the organism's environmental adaptability. Shewanella species thrive in diverse conditions ranging from deep sea to freshwater environments, possibly leading to context-dependent protein functions that could explain apparently conflicting experimental results .

How does Shewmr4_0316 compare to similar membrane proteins in other Shewanella species?

Comparative analysis of Shewmr4_0316 across Shewanella species provides valuable insights into its evolutionary conservation and potential functional importance. This approach requires:

  • Sequence-based comparison:

    • Multiple sequence alignment of homologs across Shewanella strains

    • Phylogenetic tree construction to visualize evolutionary relationships

    • Identification of conserved residues suggesting functional importance

    • Analysis of selection pressure (dN/dS ratios) on different protein regions

  • Structural comparison:

    • Homology modeling based on crystal structures of related proteins

    • Conservation mapping onto predicted structures

    • Analysis of membrane topology conservation

    • Identification of structurally conserved binding sites or active sites

  • Genomic context analysis:

    • Examination of gene neighborhood conservation

    • Identification of co-evolving genes

    • Detection of horizontal gene transfer events

    • Analysis of regulatory elements

The comparative genomic analysis would be particularly informative when examining differences between free-living Shewanella strains and those associated with hosts like marine sponges. Search result indicates significant genomic adaptations in sponge-associated strains, including specialized secretion systems and proteins containing ankyrin-repeat domains that facilitate host interactions. Examining whether Shewmr4_0316 shows evidence of adaptation in sponge-associated strains could provide clues to its functional significance in host-microbe interactions.

What role might Shewmr4_0316 play in bacterial secretion systems?

Based on the information in search result about secretion systems in Shewanella, membrane proteins like Shewmr4_0316 could potentially have significant roles in these complex molecular machines:

  • Secretion systems in Shewanella:

    • Type III Secretion Systems (T3SS): Inject effector proteins directly into host cells

    • Type IV Secretion Systems (T4SS): Transfer DNA and proteins across membranes

    • Type VI Secretion Systems (T6SS): Deliver toxins to other bacteria or host cells

  • Potential roles for membrane proteins like Shewmr4_0316:

    • Structural component of the secretion apparatus spanning the bacterial membrane

    • Regulatory role controlling secretion activity in response to environmental cues

    • Accessory protein facilitating substrate recognition

    • Energizing component providing power for the secretion process

  • Experimental approaches to investigate secretion system roles:

    • Co-immunoprecipitation with known secretion system components

    • Localization studies using fluorescent protein fusions

    • Secretion assays comparing wild-type and knockout strains

    • Site-directed mutagenesis of key residues predicted to be important

The research highlighted in demonstrates that sponge-associated Shewanella strains contain specialized secretion systems that likely contribute to their symbiotic lifestyle. These systems may deliver effector proteins that facilitate interactions with sponge hosts. If Shewmr4_0316 participates in these systems, it might play a crucial role in the ability of Shewanella to establish symbiotic relationships with marine invertebrates .

What computational approaches can predict the structure and function of Shewmr4_0316?

Computational prediction represents a powerful approach for generating hypotheses about membrane proteins like Shewmr4_0316, particularly when experimental structures are unavailable:

  • Structural prediction methods:

    • Homology modeling using related proteins as templates

    • Ab initio modeling for regions without templates

    • Hybrid approaches combining templates with de novo prediction

    • Deep learning approaches (AlphaFold2, RoseTTAFold) showing promise for membrane proteins

    • Molecular dynamics simulations to refine structures and assess stability

  • Functional prediction approaches:

    • Sequence-based function prediction (InterProScan, Pfam)

    • Structure-based function prediction (ProFunc, COACH)

    • Ligand binding site prediction (COACH, FTSite)

    • Transmembrane topology prediction (TMHMM, TOPCONS)

    • Molecular docking to predict interactions with potential ligands

  • Integration with experimental data:

    • Incorporating crosslinking constraints

    • Using limited proteolysis data to validate exposed regions

    • Validating predictions with mutagenesis experiments

    • Refining models with low-resolution structural data

For membrane proteins in Shewanella specifically, computational analyses might focus on identifying potential roles in the secretion systems or host interaction mechanisms highlighted in search result . Special attention to transmembrane regions and their orientation is crucial, as is analysis of potential interaction interfaces that might mediate protein-protein interactions within secretion system complexes.

How might post-translational modifications affect Shewmr4_0316 function?

While specific information about post-translational modifications (PTMs) of Shewmr4_0316 is not provided in the search results, analyzing potential modifications provides valuable insight into regulation and function:

  • Prediction and identification of PTMs:

    • Computational prediction using tools like NetPhos, GPS, UbPred

    • Mass spectrometry-based proteomics to identify actual modifications

    • Western blotting with modification-specific antibodies

    • Site-directed mutagenesis of predicted modification sites

  • Common bacterial PTMs to investigate:

    • Phosphorylation (Ser/Thr/Tyr) - often involved in signaling

    • Methylation - can affect protein-protein interactions

    • Acetylation - may influence protein stability

    • Lipidation - particularly relevant for membrane proteins

    • Glycosylation - less common in bacteria but present in some systems

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Phosphomimetic mutations (e.g., Ser to Asp)

    • Comparison of protein purified under different conditions

    • In vitro modification/demodification assays

  • Regulation of PTMs:

    • Identification of responsible enzymes

    • Environmental conditions affecting modification status

    • Temporal dynamics of modifications

For Shewanella membrane proteins, PTMs might be particularly relevant in the context of environmental sensing and adaptation. Phosphorylation, for instance, could regulate protein function in response to changing environmental conditions, potentially controlling activities like secretion system operation or host interaction that appear important in these bacteria .

What genomic island analysis can reveal about Shewmr4_0316?

Genomic islands (GIs) are regions of bacterial genomes that show evidence of horizontal gene transfer and often contain genes involved in adaptation to specific niches. Analysis of GIs in relation to Shewmr4_0316 could provide important evolutionary insights:

  • Identification of genomic islands:

    • Computational detection using GC content deviation, codon usage bias

    • Identification of mobility genes (integrases, transposases)

    • Comparative genomics to identify strain-specific regions

    • Analysis of flanking repeat sequences or tRNA genes

  • Content analysis of genomic islands:

    • Functional categorization of genes within GIs

    • Identification of virulence or symbiosis factors

    • Detection of secretion system components

    • Analysis of regulatory elements

  • Evolutionary implications:

    • Source organism prediction based on sequence similarity

    • Estimation of acquisition timing

    • Selection pressure analysis on GI genes

    • Correlation with ecological adaptation

Search result specifically mentions that in Shewanella sp. OPT22, a Type IV Secretion System (T4SS) was encoded within a 45 Kbp genomic island, suggesting that this secretion machinery was acquired through horizontal gene transfer. Additionally, ankyrin-repeat containing proteins (ANKs) were detected within genomic islands of Shewanella strains, potentially facilitating host interactions .

If Shewmr4_0316 is located within or functionally related to such genomic islands, this would suggest its possible role in adaptive processes, potentially relating to host interactions or environmental specialization that distinguishes different Shewanella strains.

How can Shewmr4_0316 research contribute to understanding bacterial adaptation mechanisms?

Research on membrane proteins like Shewmr4_0316 can significantly advance our understanding of bacterial adaptation to diverse environments:

  • Environmental adaptation mechanisms:

    • Potential role in sensing environmental signals (pH, temperature, salinity)

    • Contribution to membrane permeability and stress resistance

    • Function in energy generation under variable conditions

    • Involvement in attachment to surfaces or biofilm formation

  • Host interaction adaptations:

    • Possible involvement in adhesion to host tissues

    • Role in evading host immune responses

    • Contribution to nutrient acquisition from hosts

    • Function in establishing symbiotic relationships

  • Experimental approaches:

    • Comparative expression studies across environmental conditions

    • Phenotypic characterization of mutants under stress

    • Localization studies during host interactions

    • Evolution experiments to track adaptation-related changes

For Shewanella specifically, research on membrane proteins may illuminate how these bacteria adapt to diverse environments ranging from deep sea to freshwater, and how sponge-associated strains have evolved specialized mechanisms for symbiosis. Search result indicates that sponge-associated Shewanella species possess unique genomic features, including specialized secretion systems and ankyrin-repeat proteins, that likely facilitate their symbiotic lifestyle. Understanding membrane proteins in this context could reveal mechanisms underlying host-microbe interactions and environmental specialization .

What role might Shewmr4_0316 play in biofilm formation studies?

Membrane proteins often contribute to biofilm development and community formation, making this an important area of investigation for Shewmr4_0316:

  • Potential roles in biofilm formation:

    • Initial attachment to surfaces

    • Cell-cell communication within biofilms

    • Structural component of biofilm matrix

    • Sensing environmental cues for biofilm dispersal

  • Experimental approaches:

    • Static and flow cell biofilm formation assays

    • Confocal microscopy with fluorescently tagged protein

    • Comparative studies of wild-type and mutant strains

    • Expression analysis during different biofilm stages

  • Technical considerations:

    • Model surface selection (glass, plastic, natural materials)

    • Single-species vs. mixed community biofilms

    • Microscopy techniques for protein visualization

    • Environmental parameter controls (temperature, nutrient levels)

  • Applications of findings:

    • Development of biofilm prevention strategies

    • Engineering beneficial biofilms for biotechnology

    • Understanding natural biofilm communities

    • Modeling biofilm formation dynamics

For Shewanella species, which form biofilms in various environments including marine surfaces, membrane proteins may play crucial roles in establishing and maintaining these structured communities. Biofilms provide protection from environmental stressors and can facilitate interactions with hosts or other microorganisms, potentially relating to the symbiotic relationships observed in sponge-associated Shewanella strains .

How can Shewmr4_0316 be utilized in synthetic biology approaches?

Membrane proteins offer unique opportunities for synthetic biology applications, with Shewmr4_0316 potentially serving as a foundation for engineered biological systems:

  • Potential synthetic biology applications:

    • Engineered cellular sensors responding to specific environmental signals

    • Synthetic transport systems for biotechnological production

    • Designed cell-cell communication systems

    • Novel biocatalysts for membrane-associated reactions

  • Engineering strategies:

    • Domain swapping with other membrane proteins

    • Directed evolution for new functionalities

    • Rational design based on structural predictions

    • CRISPR-based genome editing for chromosomal modifications

  • Challenges and solutions:

    • Addressing membrane protein folding in heterologous hosts

    • Ensuring proper membrane insertion and orientation

    • Developing high-throughput screening for membrane protein function

    • Creating predictive models for membrane protein behavior

For Shewanella membrane proteins specifically, applications might leverage the organism's remarkable respiratory versatility and environmental adaptability. Potential applications include systems for metal reduction in bioremediation, electricity generation in microbial fuel cells, or engineered symbiotic relationships for environmental monitoring. The specialized secretion systems identified in Shewanella species could also be repurposed for delivery of designed proteins or molecules in synthetic biology applications.

What methodological advances in membrane protein research could be applied to Shewmr4_0316?

Recent technological innovations in membrane protein research offer new approaches for studying proteins like Shewmr4_0316:

  • Expression and purification advances:

    • SMALPs (Styrene Maleic Acid Lipid Particles) for detergent-free extraction

    • Nanodiscs for stable reconstitution in native-like environments

    • Fusion partners specifically designed for membrane proteins

    • Automated high-throughput screening of expression conditions

  • Structural biology innovations:

    • Cryo-electron microscopy advances for membrane proteins

    • Microcrystal electron diffraction (MicroED)

    • Serial femtosecond crystallography at X-ray free electron lasers

    • Integrative structural biology combining multiple data sources

  • Functional characterization techniques:

    • Single-molecule FRET for conformational dynamics

    • Nanoscale electrophysiology for transporter function

    • Hydrogen-deuterium exchange mass spectrometry

    • In-cell NMR spectroscopy

  • Computational advances:

    • Machine learning approaches for function prediction

    • Molecular dynamics simulations in realistic membrane environments

    • Network analysis for contextualizing protein function

    • Systems biology models incorporating membrane components

Applying these cutting-edge approaches to Shewmr4_0316 would advance not only our understanding of this specific protein but could also provide insights applicable to other membrane proteins in Shewanella and related bacteria. Given the important ecological roles of Shewanella species and their potential biotechnological applications, improved methodologies for studying their membrane proteins have broad significance .

How can research on Shewmr4_0316 inform studies on bacterial membrane proteins more broadly?

Research on specific membrane proteins like Shewmr4_0316 contributes to the broader field in several ways:

  • Methodological contributions:

    • Optimized protocols for expression and purification

    • Novel approaches for structural determination

    • Improved computational prediction methods

    • Innovative functional characterization techniques

  • Conceptual advances:

    • Understanding membrane protein evolution in different ecological contexts

    • Insights into protein-lipid interactions in bacterial membranes

    • Models of membrane protein folding pathways

    • Principles of membrane protein complex assembly

  • Comparative perspectives:

    • Identification of conserved features across bacterial phyla

    • Recognition of specialized adaptations in different ecological niches

    • Understanding of convergent evolution in membrane proteins

    • Discovery of novel functional motifs

Research on Shewanella membrane proteins specifically offers valuable perspectives on adaptation to variable environments and host interactions. The sponge-associated Shewanella species analyzed in search result demonstrate genomic adaptations including specialized secretion systems and enrichment of ankyrin-repeat containing proteins, suggesting membrane proteins play crucial roles in their ecological specializations. These insights can inform broader understanding of how bacteria adapt to specific niches through membrane protein evolution and specialization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.