Recombinant Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase (ubiA)
Description
Classification and Evolutionary Context
UbiA prenyltransferases constitute a family of membrane-bound enzymes found across all domains of life, playing essential roles in the biosynthesis of various prenylated compounds. The enzyme 4-hydroxybenzoate octaprenyltransferase, encoded by the ubiA gene, belongs to the G2 UbiA-like prenyltransferase family. Phylogenetic analysis shows that Shewanella woodyi UbiA displays relatively low sequence identity (below 50%) with other characterized prenyltransferases, though it shares approximately 23% identity with the well-characterized 4-hydroxybenzoate octaprenyltransferase from Escherichia coli . This limited sequence conservation despite functional similarity highlights the evolutionary divergence within this enzyme family while maintaining core catalytic capabilities.
Role in Ubiquinone Biosynthesis
The primary function of 4-hydroxybenzoate octaprenyltransferase is to catalyze a critical step in ubiquinone (coenzyme Q) biosynthesis. Specifically, the enzyme transfers an octaprenyl group from octaprenyl pyrophosphate to 4-hydroxybenzoate, forming 3-octaprenyl-4-hydroxybenzoate . This reaction represents one of the early committed steps in the ubiquinone biosynthetic pathway. In E. coli and other bacteria, mutations in the ubiA gene result in ubiquinone deficiency, demonstrating the enzyme's essential role in this pathway . The ability to produce functional recombinant forms of this enzyme from various bacterial species, including S. woodyi, has significantly advanced our understanding of this crucial metabolic process.
Importance in Bacterial Physiology
Ubiquinone serves as a vital electron carrier in the respiratory chain, making UbiA-catalyzed reactions essential for bacterial energy metabolism. The membrane-bound nature of UbiA correlates with its function in synthesizing components of the respiratory chain, which are embedded within the cell membrane . Genetic studies in E. coli have demonstrated that ubiA gene mutations result in respiratory deficiencies, underscoring the critical nature of this enzyme in bacterial physiology . As a marine bacterium, Shewanella woodyi likely depends on efficient ubiquinone production to support its energy needs in diverse aquatic environments, making its UbiA enzyme particularly interesting for comparative studies across bacterial species.
Amino Acid Sequence and Composition
The recombinant full-length Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase consists of 286 amino acids (residues 1-286). The complete amino acid sequence is:
"MSVKDKLEIYLRLARMDRPIGTLLLMWPCLMALVLAAGGMPDLKVLVIFIIGVVVMRACGCIINDYADRKLDSHVERTKSRPLASGEVSVKEALTLFVVMGLIAFGLVLMLNPLVVQLSFVGIILTIIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQTGTVPAEAWWLFAANWCWTVAYDT
MYAMVDRDDDLKVGIKSTAILFGKYDRQVIALFQLAALACFIIAGWAADRGLVYALGIITFVGFSLYQQKLIYGRERAPCFKAFLNNNWAGLSLFVALGVDYLV"
Analysis of this sequence reveals a protein with multiple hydrophobic regions, consistent with its membrane-bound nature. The calculated molecular mass of the protein is approximately 31.9 kDa, comparable to other UbiA family members . The amino acid composition reflects adaptations for membrane integration, with a prevalence of hydrophobic residues forming the transmembrane domains.
Transmembrane Domain Organization
Structure homology modeling of related UbiA-like prenyltransferases suggests that Shewanella woodyi UbiA contains approximately ten α-helical transmembrane domains connected by cytoplasmic and periplasmic loops . This transmembrane organization is essential for the enzyme's proper localization in the cell membrane and for creating a suitable environment for the catalytic reaction. The arrangement of these transmembrane helices likely creates a central cavity where substrate binding and catalysis occur, similar to the architecture observed in other membrane-bound prenyltransferases. This structural organization facilitates the interaction between the water-soluble aromatic substrate and the lipophilic prenyl donor in the membrane environment.
Catalytic Motifs and Binding Sites
A distinctive feature of UbiA prenyltransferases, including the Shewanella woodyi enzyme, is the presence of an aspartic acid-rich motif crucial for catalytic activity. This Asp-rich motif coordinates magnesium ions and pyrophosphate during the prenylation reaction . In Shewanella woodyi UbiA, this motif is similar to the DXXDXXXD sequence found in E. coli UbiA but distinct from patterns observed in other aromatic prenyltransferases like MenA (DXXDXXXXXD) .
While most UbiA prenyltransferases, such as E. coli UbiA and human COQ2, contain a basic arginine residue within their central cavity for binding aromatic substrates (e.g., 4-hydroxybenzoate), comparative analysis suggests that Shewanella woodyi UbiA and related G2-Ptases likely harbor a tyrosine residue (Tyr-56) that may fulfill a similar coordinative function . Additionally, a conserved arginine residue (possibly corresponding to R145 in related enzymes) might be involved in substrate coordination .
Comparison with Other UbiA Family Members
Shewanella woodyi UbiA shares approximately 23% sequence identity with the well-studied 4-hydroxybenzoate octaprenyltransferase from E. coli . It also shows approximately 33% identity with a putatively assigned digeranylgeranylglyceryl phosphate synthase from Sulfurisphaera tokodaii and about 31% identity with a membrane-bound prenyltransferase from the plant Avena sativa . Despite these relatively low sequence identities, the core structural elements and catalytic mechanisms appear to be conserved across the UbiA family, reflecting the fundamental importance of these enzymes in prenylation reactions across diverse organisms.
Substrate Specificity and Binding
The natural substrate for Shewanella woodyi UbiA is 4-hydroxybenzoate, which undergoes prenylation with an octaprenyl group derived from octaprenyl pyrophosphate. Studies of related UbiA-like prenyltransferases have revealed varying degrees of substrate promiscuity. For instance, the related UbiA-297 enzyme shows a preference for quinoline derivatives such as 8-hydroxyquinoline-2-carboxylic acid (8-HQA) and quinaldic acid as acceptor substrates, while using farnesyl pyrophosphate as the prenyl donor .
The substrate binding likely occurs within a central cavity formed by the transmembrane helices, with specific residues coordinating the aromatic substrate and the prenyl donor to ensure proper orientation for catalysis. The hydrophobic nature of the transmembrane domains creates an environment that facilitates the interaction between the water-soluble aromatic substrate and the lipophilic prenyl donor.
Cofactor Requirements
Like other members of the UbiA family, Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase requires magnesium ions as a cofactor for optimal enzymatic activity . These divalent cations play a crucial role in coordinating the pyrophosphate group of the prenyl donor substrate and stabilizing the transition state during catalysis. The Asp-rich motif in the enzyme's active site is responsible for coordinating these magnesium ions . This requirement for magnesium has been demonstrated in studies of E. coli UbiA, where the enzyme showed optimal activity in the presence of magnesium ions . The dependence on this cofactor is a characteristic feature of prenyltransferases and distinguishes them from many other enzyme families.
Catalytic Mechanism of Prenylation
The catalytic mechanism of UbiA prenyltransferases involves several key steps. First, the enzyme binds both the aromatic acceptor (4-hydroxybenzoate) and the prenyl donor (octaprenyl pyrophosphate) within its active site. The magnesium ions, coordinated by the Asp-rich motif, activate the pyrophosphate group of the prenyl donor, making it more susceptible to nucleophilic attack. The hydroxyl group of 4-hydroxybenzoate then performs a nucleophilic attack on the C1 position of the prenyl group, forming a new carbon-carbon bond. This reaction results in the release of pyrophosphate and the formation of 3-octaprenyl-4-hydroxybenzoate . The membrane environment of the enzyme likely facilitates this reaction by providing a hydrophobic milieu that accommodates the lipophilic prenyl chain.
Expression Systems and Optimization
Recombinant Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase has been successfully expressed in Escherichia coli expression systems . The protein is typically expressed with an N-terminal histidine tag to facilitate purification . Expression of membrane proteins presents significant challenges due to their hydrophobic nature and the potential for misfolding or aggregation. Optimization of expression conditions, including temperature, induction timing, and inducer concentration, is critical for obtaining functional enzyme.
For heterologous expression of related UbiA-like prenyltransferases, E. coli BL21 strains have been used successfully . The expression constructs typically include codon-optimized sequences for efficient translation in the host organism. Induction protocols using isopropyl β-D-1-thiogalactopyranoside (IPTG) are commonly employed for controlled expression from T7 promoter-based vectors such as pET28 .
Purification Strategies
The purification of recombinant Shewanella woodyi UbiA presents challenges common to membrane proteins. The typical purification workflow involves cell lysis, membrane fraction isolation, and protein extraction using detergents . For His-tagged recombinant UbiA, immobilized metal affinity chromatography serves as the primary purification step.
Table 1: Specifications of Recombinant Shewanella woodyi UbiA Protein
| Parameter | Specification |
|---|---|
| Species | Shewanella woodyi |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-286) |
| Form | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | -20°C/-80°C upon receipt, aliquoting necessary for multiple use |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Quality Assessment and Analytical Methods
Quality assessment of recombinant Shewanella woodyi UbiA typically includes SDS-PAGE analysis to confirm protein size and purity . For functional characterization, enzymatic assays monitoring the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate can be performed. These assays often employ high-performance liquid chromatography, mass spectrometry, or radioisotope-based methods to detect product formation.
Based on studies of related enzymes, activity assays can be conducted using membrane fractions containing the recombinant protein, with the addition of appropriate substrates (4-hydroxybenzoate and prenyl pyrophosphate), magnesium as a cofactor, and suitable buffer conditions . Western blot analysis using antibodies against the His-tag can confirm the presence of the recombinant protein in membrane fractions, as demonstrated for related UbiA-like prenyltransferases .
Use in Enzymatic Studies
Recombinant Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase serves as a valuable tool for studying prenylation reactions and ubiquinone biosynthesis. The availability of the recombinant enzyme facilitates investigations into substrate specificity, kinetic parameters, and structure-function relationships. Studies of similar UbiA-like prenyltransferases have revealed insights into substrate preferences and catalytic mechanisms, such as the farnesylation of quinoline derivatives by the related UbiA-297 enzyme .
Additionally, the enzyme can be used as a model system for understanding membrane protein folding, stability, and integration in lipid bilayers. Comparative analysis with other UbiA family members can provide insights into the evolution of prenylation mechanisms across different species. Site-directed mutagenesis studies targeting key residues, such as those in the Asp-rich motif, could further elucidate the structural determinants of substrate recognition and catalysis.
Potential Biotechnological Applications
The ability of UbiA enzymes to catalyze prenylation reactions has potential applications in biotechnology and synthetic biology. Prenylated compounds often exhibit enhanced bioactivity compared to their non-prenylated counterparts, making them valuable in pharmaceutical development. Recombinant UbiA enzymes could be employed in chemoenzymatic synthesis of prenylated aromatic compounds, offering advantages over traditional chemical methods in terms of regioselectivity and reaction conditions.
The substrate promiscuity observed in related UbiA-like prenyltransferases suggests that Shewanella woodyi UbiA might also accept non-natural substrates, potentially expanding the repertoire of prenylated compounds that can be enzymatically synthesized. Whole-cell biocatalysts expressing recombinant UbiA could provide a sustainable approach for producing valuable prenylated compounds, as demonstrated by the successful production of prenylated 8-hydroxyquinoline-2-carboxylic acid in E. coli cultures expressing related UbiA-297 .
Role in Understanding Bacterial Metabolism
The study of Shewanella woodyi UbiA contributes to our understanding of bacterial energy metabolism and adaptation mechanisms. As a key enzyme in ubiquinone biosynthesis, UbiA plays a crucial role in the electron transport chain and cellular respiration. The E. coli ubiA gene has been mapped to minute 79 on the chromosome, and mutations in this gene result in ubiquinone deficiency, demonstrating its essential role in energy metabolism .
The identification of UbiA homologs in various bacterial species, including marine bacteria like Shewanella woodyi, highlights the conservation of ubiquinone biosynthesis across diverse ecological niches. Comparative studies of UbiA enzymes from different bacterial species can provide insights into how these organisms have adapted their energy metabolism to specific environmental conditions. Furthermore, the essential nature of ubiquinone in many bacterial species makes the biosynthetic pathway a potential target for antibacterial drug development.
Comparative Analysis with Other Bacterial Species
Comparative analysis of UbiA enzymes from different bacterial species reveals both conserved features and species-specific adaptations. The Shewanella woodyi UbiA shows similarities to the well-characterized E. coli enzyme in terms of its fundamental function but differs in specific sequence features . These differences may reflect adaptations to the unique ecological niche and metabolic requirements of S. woodyi as a marine bacterium.
Studies of related UbiA-like prenyltransferases have identified a group designated as UbiA-297, which is part of a conserved operon (ebo gene cluster) found in various bacterial taxa, including marine Flavobacteria and the genus Saccharomonospora . While Shewanella woodyi UbiA is not part of this specific group, comparative analysis with these related enzymes provides insights into the diversity and evolution of prenyltransferases across bacterial lineages.
Future Research Directions
Future research on Shewanella woodyi UbiA could focus on several promising directions. Structural studies using techniques such as cryo-electron microscopy or X-ray crystallography would provide more detailed insights into the three-dimensional organization of the enzyme and its interaction with substrates. Such structural information would be valuable for understanding the catalytic mechanism and for rational design of enzyme variants with novel properties.
Product Specs
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: swd:Swoo_4497
STRING: 392500.Swoo_4497
Q&A
What is the basic function of Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase (ubiA)?
Shewanella woodyi 4-hydroxybenzoate octaprenyltransferase (ubiA) is a membrane-bound enzyme that catalyzes a critical step in ubiquinone (coenzyme Q) biosynthesis. The enzyme specifically transfers an octaprenyl group from octaprenyl pyrophosphate to 4-hydroxybenzoate, forming 3-octaprenyl-4-hydroxybenzoate. This prenylation reaction represents one of the early committed steps in the ubiquinone biosynthetic pathway, which is essential for cellular respiration and energy metabolism in S. woodyi .
The enzyme belongs to the UbiA prenyltransferase family (EC 2.5.1.-) and is also known as 4-HB polyprenyltransferase. In S. woodyi, this enzyme is encoded by the ubiA gene (locus tag: Swoo_4497) and consists of 286 amino acids . The catalytic function requires magnesium ions as cofactors, which are coordinated by conserved aspartate-rich motifs within the protein.
How does S. woodyi ubiA compare with similar enzymes from other organisms?
Comparative sequence analysis reveals that S. woodyi ubiA shares varying degrees of similarity with other prenyltransferases:
The relatively low sequence identity between S. woodyi ubiA and UbiA-297 from marine Flavobacteria (23%) suggests significant functional divergence, which is reflected in their substrate preferences. While S. woodyi ubiA specifically prenylates 4-hydroxybenzoate in the ubiquinone biosynthetic pathway, UbiA-297 shows preference for quinoline derivatives such as 8-hydroxyquinoline-2-carboxylic acid (8-HQA) and quinaldic acid .
This divergence highlights the specialized roles that different prenyltransferases have evolved to fulfill in various organisms, despite sharing a common catalytic mechanism and structural organization.
What experimental approaches are recommended for heterologous expression of active S. woodyi ubiA?
Heterologous expression of membrane-bound S. woodyi ubiA presents several challenges that can be addressed through careful experimental design:
-
Expression System Selection:
-
Escherichia coli BL21(DE3) has been successfully used for expressing membrane-bound prenyltransferases like UbiA-297
-
The pET28 vector system provides good control over expression levels through IPTG induction
-
Consider specialized E. coli strains designed for membrane protein expression (C41, C43) if toxicity is observed
-
-
Optimization of Expression Conditions:
-
Induction at lower temperatures (16-20°C) can improve proper membrane integration
-
Moderate IPTG concentrations (0.1-0.5 mM) help balance expression level with proper folding
-
Extended expression periods (16-24 hours) at reduced temperatures often yield higher amounts of active protein
-
-
Membrane Fraction Isolation:
-
Gentle cell lysis methods (e.g., enzymatic lysis with lysozyme followed by mild sonication)
-
Differential centrifugation to separate membrane fractions (10,000×g to remove cell debris, followed by 100,000×g to collect membranes)
-
Resuspension of membrane fractions in buffer containing glycerol (10-20%) to stabilize the enzyme
-
-
Activity Verification:
For UbiA-297, which shares some similarity with S. woodyi ubiA, researchers have successfully expressed the enzyme in E. coli BL21 using the pET28 system, and directly used membrane fractions for enzymatic assays, demonstrating the feasibility of this approach for membrane-bound prenyltransferases .
What is known about the substrate specificity of S. woodyi ubiA compared to other prenyltransferases?
While specific substrate profiling data for S. woodyi ubiA is limited in the available literature, comparisons with related prenyltransferases provide valuable insights:
-
Primary Substrate Preference:
-
Comparative Substrate Specificity:
-
Unlike UbiA-297, which shows activity toward quinoline-type substrates (8-HQA, quinaldic acid), 8-hydroxyquinoline, and 1,3-dihydroxynaphthalene , S. woodyi ubiA likely has narrower substrate specificity focused on 4-hydroxybenzoate
-
UbiA-297 showed little to no activity with phenols or catechols , suggesting that S. woodyi ubiA might similarly require specific structural features for substrate recognition
-
-
Prenyl Donor Preference:
These differences in substrate specificity reflect the distinct metabolic roles of these enzymes: S. woodyi ubiA functions specifically in ubiquinone biosynthesis, while UbiA-297 may be involved in secondary metabolite production.
How can researchers optimize enzymatic assays for S. woodyi ubiA activity?
Based on successful approaches with related prenyltransferases, the following recommendations can guide the development of robust enzymatic assays for S. woodyi ubiA:
-
Reaction Components:
-
Buffer: Tris-HCl or HEPES buffer (50-100 mM, pH 7.5-8.0)
-
Cofactor: Magnesium ions (5-10 mM MgCl₂) are essential for activity
-
Substrates: 4-hydroxybenzoate (50-200 μM) and octaprenyl pyrophosphate (25-100 μM)
-
Membrane fraction: Containing heterologously expressed S. woodyi ubiA
-
Detergent: Low concentrations (0.05-0.1%) of mild detergents like DDM may enhance activity
-
-
Reaction Conditions:
-
Product Detection Methods:
-
Controls:
-
Alternative Approaches:
The successful expression and activity assessment of UbiA-297 using membrane fractions and HRMS/MS detection provides a valuable methodological template that can be adapted for S. woodyi ubiA enzymatic assays .
What strategies can address common challenges in membrane protein expression and activity assessment?
Researchers working with S. woodyi ubiA may encounter several common challenges associated with membrane protein expression and enzymatic characterization:
-
Low Expression Yields:
-
Challenge: Membrane proteins often express poorly in heterologous systems
-
Solution: Optimize codon usage for expression host, lower induction temperature to 16-20°C, and consider fusion tags that enhance expression
-
Methodology: Compare different E. coli strains (BL21, C41, C43) and expression vectors (pET28, pBAD) to identify optimal combinations
-
-
Protein Misfolding and Aggregation:
-
Challenge: Improper membrane integration leading to inactive protein
-
Solution: Include osmolytes (glycerol 5-10%, trehalose) in expression media and buffers
-
Methodology: Monitor protein distribution between membrane and inclusion body fractions through Western blotting
-
-
Limited Enzyme Stability:
-
Challenge: Rapid activity loss during membrane preparation
-
Solution: Minimize exposure to air, include reducing agents (DTT or β-mercaptoethanol) and protease inhibitors in all buffers
-
Methodology: Compare fresh preparations with stored samples to establish stability profiles
-
-
Detergent Interference:
-
Challenge: Detergents needed for membrane protein handling may inhibit activity
-
Solution: Screen multiple detergents at various concentrations to identify compatible options
-
Methodology: Compare activity in membrane fractions with and without added detergents
-
-
Detection Sensitivity:
For UbiA-297, researchers successfully addressed these challenges by using membrane fractions directly for activity assays rather than attempting complete purification, which often compromises activity . This approach is likely to be effective for S. woodyi ubiA as well.
How can researchers distinguish between enzymatic and non-enzymatic prenylation reactions?
Distinguishing true enzymatic activity from chemical or artifactual prenylation is critical when studying S. woodyi ubiA:
-
Essential Control Experiments:
-
Negative controls: Use membrane fractions from E. coli cultures harboring empty expression plasmids to identify background prenylation
-
Heat inactivation: Compare activity between native and heat-denatured (95°C for 10 minutes) enzyme preparations
-
Component omission: Perform parallel reactions omitting key components (enzyme, substrate, prenyl donor, or Mg²⁺)
-
-
Characteristics of Enzymatic vs. Non-enzymatic Reactions:
Parameter Enzymatic Prenylation Non-enzymatic Prenylation Mg²⁺ dependence Strongly dependent Often Mg²⁺-independent Substrate specificity Selective for specific substrates Less selective Regioselectivity Defined prenylation position Random or multiple positions pH dependence Optimal activity in defined pH range Less pH-dependent Kinetics Saturable (Michaelis-Menten) Linear with substrate concentration -
Analytical Approaches:
-
Quantitative Assessment:
-
Calculate signal-to-background ratios by comparing product formation in active vs. control samples
-
Establish dose-response relationships between enzyme concentration and product formation
-
Determine kinetic parameters (Km, Vmax) that should follow Michaelis-Menten behavior for enzymatic reactions
-
For UbiA-297, researchers confirmed the structure of enzymatically prenylated 8-HQA through MS-guided purification and NMR analysis, providing definitive evidence of enzymatic activity . Similar rigorous analytical approaches should be applied when characterizing S. woodyi ubiA.
What methods can be used to investigate the relationship between S. woodyi ubiA activity and cellular physiology?
Understanding the physiological relevance of S. woodyi ubiA activity requires connecting enzymatic function to cellular processes:
-
Gene Expression Analysis:
-
Approach: Measure ubiA gene expression under different growth conditions
-
Methodology: RT-qPCR or RNA-seq to quantify ubiA transcript levels
-
Interpretation: Correlate expression patterns with cellular ubiquinone requirements
-
-
Metabolic Profiling:
-
Approach: Quantify ubiquinone levels and intermediates in S. woodyi
-
Methodology: LC-MS/MS-based targeted metabolomics
-
Interpretation: Assess how environmental conditions affect ubiquinone biosynthesis
-
-
Integrated Physiological Studies:
-
Approach: Connect ubiquinone biosynthesis to bioluminescence in S. woodyi
-
Methodology: Monitor bioluminescence intensity in relation to electron transport chain modifications
-
Interpretation: S. woodyi bioluminescence is affected by electron acceptors that may influence ubiquinone-dependent processes
-
-
Genetic Manipulation Strategies:
-
Approach: Create ubiA knockdown or overexpression strains
-
Methodology: Use inducible expression systems or antisense RNA approaches
-
Interpretation: Assess how altered ubiA levels affect growth, respiration, and stress resistance
-
-
Bioelectrochemical Applications:
Research has demonstrated that S. woodyi bioluminescence is repressed by soluble electron acceptors such as nitrate, Co(II), and Zn(II) at electrochemical potentials below 0.2 V vs. NHE . While the exact mechanism remains unclear, this phenomenon suggests complex interactions between electron transport chains (which involve ubiquinone) and cellular bioluminescence, potentially implicating ubiA-dependent processes in these physiological responses.
What insights can be gained from structural analysis of S. woodyi ubiA and related enzymes?
Although a high-resolution structure of S. woodyi ubiA is not yet available in the literature, valuable insights can be derived from comparative structural analysis:
-
Transmembrane Domain Organization:
-
Catalytic Site Architecture:
-
Like other prenyltransferases, S. woodyi ubiA likely contains conserved aspartate-rich motifs for Mg²⁺ coordination
-
The catalytic site must accommodate both the hydrophilic pyrophosphate moiety and the hydrophobic prenyl chain
-
Specific residues likely position the aromatic substrate for regioselective prenylation
-
-
Substrate Binding Determinants:
-
Hydrophobic residues likely form a prenyl binding pocket that accommodates the octaprenyl chain
-
Polar residues likely interact with the carboxyl and hydroxyl groups of 4-hydroxybenzoate
-
The enzyme's preference for 4-hydroxybenzoate over other aromatic compounds suggests specific recognition elements
-
-
Structural Homology Insights:
-
Membrane Integration and Active Site Accessibility:
-
The active site likely resides within the membrane bilayer but must be accessible to cytoplasmic substrates
-
Specific channels or portals may allow substrate entry from the cytoplasmic side
-
These structural considerations provide a foundation for understanding the catalytic mechanism and substrate specificity of S. woodyi ubiA, informing experimental approaches to investigate structure-function relationships.
How might rational protein engineering be applied to modify S. woodyi ubiA properties?
Rational protein engineering could enable the modification of S. woodyi ubiA for enhanced stability, altered substrate specificity, or improved catalytic efficiency:
-
Stability Enhancement Strategies:
-
Target residues: Surface-exposed hydrophobic residues that may cause aggregation
-
Modifications: Introduction of stabilizing salt bridges or disulfide bonds
-
Expected outcome: Improved thermostability and extended shelf-life
-
Experimental approach: Alanine scanning followed by targeted mutations based on structural predictions
-
-
Substrate Specificity Alterations:
-
Target residues: Amino acids lining the substrate binding pocket
-
Modifications: Mutations that alter the size, shape, or polarity of the binding site
-
Expected outcome: Acceptance of non-native substrates such as quinoline derivatives (like UbiA-297)
-
Experimental approach: Structure-guided mutations followed by activity screening with alternate substrates
-
-
Catalytic Efficiency Optimization:
-
Target residues: Conserved residues near but not directly in the active site
-
Modifications: Conservative substitutions that optimize substrate positioning
-
Expected outcome: Enhanced turnover rate or improved Km values
-
Experimental approach: Steady-state kinetic analysis of mutant variants
-
-
Prenyl Chain Length Selectivity:
-
Target residues: Amino acids defining the hydrophobic prenyl binding pocket
-
Modifications: Alterations that expand or contract the prenyl binding channel
-
Expected outcome: Shifted preference for shorter (GPP, FPP) or longer prenyl donors
-
Experimental approach: Activity assays with prenyl donors of varying chain lengths
-
-
Lessons from Natural Variants:
A systematic approach combining computational modeling, site-directed mutagenesis, and functional assays would be most effective for rational engineering of S. woodyi ubiA properties. The relatively low sequence identity between S. woodyi ubiA and characterized homologs like UbiA-297 suggests potentially unique structural features that could offer novel opportunities for protein engineering.
What unexplored aspects of S. woodyi ubiA warrant further investigation?
Several promising research directions could expand our understanding of S. woodyi ubiA:
-
Comprehensive Substrate Profiling:
-
Detailed Mechanistic Studies:
-
Elucidate the order of substrate binding (random vs. ordered mechanism)
-
Determine rate-limiting steps in the catalytic cycle
-
Investigate potential allostery or cooperativity in substrate binding
-
-
Ecological and Evolutionary Context:
-
Compare ubiA sequences across different Shewanella species to trace evolutionary relationships
-
Investigate how habitat-specific adaptations might influence enzyme properties
-
Study potential horizontal gene transfer events that shaped ubiA evolution
-
-
Physiological Role Beyond Ubiquinone Biosynthesis:
-
Biotechnological Applications:
These research directions would contribute valuable insights into both the fundamental biochemistry of prenyltransferases and potential applications of S. woodyi ubiA in biotechnology and synthetic biology.
How might comparative studies between S. woodyi ubiA and UbiA-297 advance our understanding of prenyltransferase evolution?
Comparative analysis of S. woodyi ubiA and UbiA-297 from marine Flavobacteria offers a unique opportunity to study evolutionary divergence within the prenyltransferase family:
-
Sequence-Function Relationships:
-
Substrate Specificity Evolution:
-
UbiA-297 preferentially farnesylates quinoline derivatives , while S. woodyi ubiA targets 4-hydroxybenzoate
-
Identifying the molecular basis for this divergence would reveal how substrate specificity evolves
-
Chimeric enzymes combining domains from both proteins could test hypotheses about specificity determinants
-
-
Evolutionary Pressure Analysis:
-
Comparing selection pressures across different protein regions could identify functionally critical elements
-
Correlation of conservation patterns with structural features may reveal evolutionary constraints
-
Analysis of coevolution between enzyme residues and metabolic pathways could provide insights into adaptation
-
-
Horizontal Gene Transfer Investigation:
-
Assess whether ubiA genes have undergone horizontal gene transfer between marine bacteria
-
Compare genomic context of ubiA genes across species to identify conserved operons or gene clusters
-
Study how acquisition of different prenyltransferases might have enabled ecological adaptations
-
-
Functional Convergence and Divergence:
-
Despite their evolutionary distance, these enzymes may share common catalytic mechanisms
-
Testing whether UbiA-297 can complement S. woodyi ubiA function (and vice versa) would assess functional interchangeability
-
Identifying instances of convergent evolution could reveal multiple solutions to similar biochemical challenges
-
The limited sequence similarity but shared enzymatic function between these proteins makes them excellent models for studying how enzyme function diversifies while maintaining core catalytic capabilities.
