Recombinant Shewanella woodyi ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthesis

Subunit a is a core component of the F₀ sector, responsible for proton translocation across the bacterial membrane. It interacts with subunit c to form a proton channel, driving the rotation of the F₁ ATP synthase to synthesize ATP . In S. woodyi, this subunit likely adapts to low-temperature environments, consistent with the species’ cold-adapted lifestyle .

Key Functional Features:

  • Proton Translocation: Facilitates H⁺ movement across the membrane via transmembrane helices .

  • Subunit Interaction: Partners with ATP synthase subunit c (atpE) to form the rotor-stator interface .

  • Energy Coupling: Enables the conversion of proton motive force into chemical energy .

Production and Applications

The recombinant protein is commercially available in quantities ranging from 50 µg, with customizable tags and buffer systems .

ParameterDetails
Source OrganismShewanella woodyi (strain ATCC 51908/MS32)
Expression HostE. coli
Purity>90% (SDS-PAGE validated)
Storage Conditions-20°C or -80°C (avoid repeated freeze-thaw cycles)

Research Applications:

  • Structural Studies: Used to investigate proton translocation mechanisms and F₀-F₁ interactions .

  • ELISA Development: Serves as an antigen for detecting antibodies against ATP synthase subunit a .

  • Bioenergetic Experiments: Examines ATP synthesis efficiency under varying proton gradients .

Comparative Analysis of ATP Synthase Subunits

OrganismSubunit a Features
Shewanella woodyi264 aa, cold-adapted, H⁺ translocation
E. coli247 aa, H⁺ translocation, two transmembrane helices
Pseudomonas modestumNa⁺ translocation, hybrid rotor structure

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; Swoo_4904; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Shewanella woodyi (strain ATCC 51908 / MS32)
Target Names
atpB
Target Protein Sequence
MAATGEALTPQGYIQHHLTNLSVGEGFWTWHIDSLFFSVGLGVLFLWLFRSVGKKATTGV PGKLQCFVEMIVEFVDSSVKETFHGRNPVIAPLALTIFVWVFMMNFMDMVPVDWIPELAM AAGIPYMKVVPTTDLNITFSMAIGVFLLIIYYSIKVKGISGFVKELTLQPFNHKAMIPVN LLLETVTLIAKPISLALRLFGNLYAGELIFILIALMYGANWALSTLGVTLQLGWLIFHIL VITLQAFIFMMLTIVYLSMAHEDH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of subunit a (atpB) in S. woodyi ATP synthase?

Subunit a (atpB) in S. woodyi ATP synthase plays a critical role in proton translocation across the membrane. This subunit forms part of the membrane-embedded Fo domain and contains the proton channel that facilitates the movement of protons. The proton gradient drives the rotation of the c-ring, which is mechanically coupled to the synthesis of ATP in the F1 domain.

Based on studies of ATP synthase structure, subunit a has a molecular mass of approximately 24.8 kDa and works in coordination with other membrane subunits . In the absence of subunit a, ATP synthase can still form a complex with a mass of approximately 550 kDa (compared to the complete 597 kDa complex), indicating that while assembly can proceed without it, the complex would lack full functionality .

How does ATP synthase contribute to S. woodyi metabolism?

ATP synthase is central to energy metabolism in S. woodyi, converting ADP and inorganic phosphate (Pi) into ATP using the energy from proton motive force. The enzyme functions through a rotary mechanism where protons moving through the Fo domain drive rotation that enables catalysis in the F1 domain.

S. woodyi, like other Shewanella species, requires significant amounts of ATP for both growth-dependent and non-growth-dependent cellular processes. Similar to S. oneidensis MR-1, S. woodyi likely has growth rate-dependent ATP requirements (GAR) as well as non-growth rate-dependent ATP requirements (NGAR) . In S. oneidensis, the NGAR has been measured at 1.03 mmol ATP/(g AFDW×h) with GAR at 220.22 mmol ATP/g AFDW . Though specific values for S. woodyi have not been determined, these figures provide a reference point for understanding ATP utilization in this genus.

What genomic features characterize S. woodyi ATP synthase genes?

S. woodyi strains exhibit substantial genomic polymorphism despite sharing common characteristics. Pulsed-field gel electrophoresis (PFGE) analysis has revealed restriction fragment pattern homology ranging from 56-89% with SmaI and 82-94% with NotI restriction enzymes . This genomic diversity likely extends to the genes encoding ATP synthase subunits.

How do environmental factors affect S. woodyi ATP synthase expression and activity?

Environmental conditions significantly impact S. woodyi physiology, including ATP synthase expression and function. As bioluminescent marine bacteria, S. woodyi strains adapt to various growth conditions that affect enzyme activity and cellular energetics.

Different growth conditions have been shown to affect biofilm formation in S. woodyi , which could indirectly influence ATP synthase activity. Biofilm formation changes cellular metabolism and can create microenvironments with altered pH and oxygen availability, potentially affecting the proton gradient that drives ATP synthase.

The regulation of ATP synthase in Shewanella species may also involve cyclic dinucleotides (CDNs) like c-di-GMP, which has been shown to regulate both biofilm formation and the expression of electron transport-related genes in Shewanella species . Although direct evidence linking c-di-GMP to ATP synthase regulation in S. woodyi is lacking, this regulatory network may coordinate energy generation with biofilm development.

What are the structural differences between S. woodyi ATP synthase and those of other species?

The amino acid composition of subunit a may contain adaptations specific to S. woodyi's marine environment, potentially affecting proton translocation efficiency or stability under different salt concentrations. These structural variations could be explored through comparative sequence analysis and structural modeling based on the resolved structures of ATP synthases from other species.

Genetic diversity observed among S. woodyi strains suggests potential variations in ATP synthase genes that could be correlated with differences in metabolic capabilities, growth rates, or resistance to environmental stressors.

How does the c-di-GMP signaling network influence ATP synthase in S. woodyi?

The c-di-GMP signaling network is a key regulator of biofilm formation in Shewanella species . This second messenger is synthesized by diguanylate cyclases (DGCs) containing GGDEF domains and degraded by phosphodiesterases (PDEs) with EAL/HD-GYP domains .

In S. oneidensis MR-1, c-di-GMP has been shown to regulate the expression of c-type cytochromes involved in extracellular electron transfer . Although direct regulation of ATP synthase by c-di-GMP in S. woodyi has not been demonstrated, the interconnected nature of energy metabolism suggests potential regulatory links.

Understanding this regulatory network requires investigating the presence of c-di-GMP responsive elements in the promoter regions of ATP synthase genes and examining the effects of manipulating intracellular c-di-GMP levels on ATP synthase expression and activity in S. woodyi.

What expression systems are optimal for producing recombinant S. woodyi atpB?

For expression of recombinant S. woodyi atpB, E. coli-based systems remain the standard approach, though several considerations must be addressed:

Expression System Optimization for S. woodyi atpB:

ParameterRecommendationRationale
Host strainC41(DE3) or C43(DE3)Better for membrane protein expression
VectorpET with T7 promoterControllable, high-level expression
InductionIPTG 0.1-0.5 mM at OD600 0.6-0.8Prevents formation of inclusion bodies
Temperature18-25°C post-inductionSlows expression, improves folding
MediaTerrific Broth with appropriate antibioticsSupports higher cell density
Additives1% glucose pre-inductionPrevents leaky expression

Since atpB encodes a hydrophobic membrane protein, expression conditions must be carefully optimized to prevent protein aggregation. Lower temperatures and reduced inducer concentrations generally improve the yield of properly folded protein.

What purification strategies yield functional recombinant S. woodyi atpB?

Purification of membrane proteins like atpB requires specialized approaches to maintain structural integrity and function:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (DDM, LMNG, or digitonin)

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography for final purification and buffer exchange

To assess the functional state of purified atpB, it must be reconstituted with other ATP synthase subunits. Alternatively, incorporation into proteoliposomes and measurement of proton translocation can provide functional data on the isolated subunit.

How can site-directed mutagenesis help identify critical residues in S. woodyi atpB?

Site-directed mutagenesis is a powerful approach to understanding structure-function relationships in atpB:

  • Target conserved amino acids found in the proton channel based on sequence alignments with ATP synthases of known structure

  • Focus on residues that interact with the c-ring interface

  • Substitute residues with similar or contrasting properties to assess functional importance

  • Evaluate effects on ATP synthesis, proton translocation, and assembly with other subunits

Studies of ATP synthase inhibition have identified catalytic site residues including αPhe-291, αSer-347, αGly-351, αArg-376, βLys-155, βArg-182, βAsn-243, and βArg-246 that interact with phosphate analogs . Similar approaches could identify critical residues in subunit a that are involved in proton translocation or interaction with the c-ring.

How to address issues with recombinant S. woodyi atpB expression?

Expression of membrane proteins like atpB frequently encounters challenges:

Common Expression Issues and Solutions:

ProblemPotential Solution
Low yieldOptimize codon usage for expression host; use stronger promoters
Protein aggregationReduce expression temperature; use solubility-enhancing fusion tags (SUMO, MBP)
Toxicity to hostUse tightly controlled inducible promoters; use specialized host strains
Proteolytic degradationInclude protease inhibitors; use protease-deficient strains
Improper membrane insertionCo-express with chaperones; use membrane-targeting sequences

For S. woodyi atpB specifically, the high genomic diversity observed among strains suggests potential variations in codon usage or protein sequence that could affect expression. Selecting a sequence variant with optimal properties or creating a synthetic gene with optimized codons may improve expression outcomes.

What strategies can validate the functional integrity of recombinant S. woodyi ATP synthase?

Validating functional integrity of recombinant ATP synthase requires multiple complementary approaches:

  • ATP synthesis/hydrolysis assays: Measure the enzyme's ability to synthesize ATP from ADP and Pi or hydrolyze ATP using colorimetric or bioluminescence-based methods

  • Proton translocation assays: Use pH-sensitive fluorescent dyes to monitor proton movement across membranes in reconstituted systems

  • Structural integrity assessment: Use circular dichroism spectroscopy or limited proteolysis to evaluate protein folding

  • Inhibitor sensitivity tests: ATP synthase has distinct binding sites for various inhibitors including polyphenols (resveratrol, piceatannol, quercetin), peptides (melittin, aurein), and antibiotics (oligomycin, efrapeptins) . Differential sensitivity to these inhibitors can provide functional insights.

How might S. woodyi ATP synthase be engineered for enhanced functionality?

Engineering S. woodyi ATP synthase could focus on several objectives:

  • Modifying proton-binding residues in subunit a to alter pH dependence

  • Engineering interfaces between subunits to enhance stability or assembly efficiency

  • Introducing mutations that alter sensitivity to specific inhibitors

  • Creating chimeric enzymes with subunits from different species to investigate functional compatibility

These approaches could yield insights into the fundamental mechanisms of ATP synthase function while potentially generating variants with desirable properties for biotechnological applications.

What insights might S. woodyi ATP synthase provide about adaptation to marine environments?

As a marine bacterium, S. woodyi has adapted to specific environmental conditions. Its ATP synthase may possess unique features that enable function in high-salt environments or under the pressure conditions of deep marine settings.

Comparative analysis of ATP synthase from S. woodyi and terrestrial bacteria could reveal adaptations specific to marine environments. These might include differences in ion selectivity, pH optimum, or structural stability that reflect the evolutionary pressures of S. woodyi's ecological niche.

The substantial genomic polymorphism observed among S. woodyi strains suggests ongoing evolutionary adaptation, which may extend to energy-generating systems like ATP synthase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.