Recombinant Shewanella woodyi ATP synthase subunit b (atpF)

What is the optimal storage condition for recombinant Shewanella woodyi ATP synthase subunit b (atpF)?

Recombinant S. woodyi ATP synthase subunit b (atpF) requires specific storage conditions to maintain structural integrity and biological activity. The protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular use or at -80°C for extended storage periods . For ongoing experiments, working aliquots can be stored at 4°C for up to one week . It is critical to avoid repeated freeze-thaw cycles as they can significantly compromise protein stability and functionality . When preparing aliquots, use sterile technique and consider single-use volumes to minimize freeze-thaw cycles. The addition of protease inhibitors may be beneficial for longer-term stability experiments, particularly when working with complex protein interaction studies.

How does S. woodyi ATP synthase subunit b differ structurally from other bacterial ATP synthase b subunits?

The S. woodyi ATP synthase subunit b (atpF/Swoo_4902) possesses some distinctive structural characteristics compared to other bacterial homologs. The full-length protein consists of 156 amino acids with a sequence (MNINATLLGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKDAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGQAEIEAERNRVKEDLRKQVATLAIAGAEKILERSIDEAAHSDIVNKLVAEL) that contains both hydrophobic transmembrane regions and hydrophilic domains . While the general architecture resembles other bacterial F-type ATP synthase b subunits, comparative analyses with structures like those from E. coli and Bacillus PS3 show that there are subtle but potentially significant differences in the transmembrane α-helices and their positioning relative to subunit a . These structural distinctions may reflect adaptations to S. woodyi's marine environment and its specific energy requirements. Based on research with related bacterial ATP synthases, the b subunit typically forms a dimer (b₂) that serves as part of the peripheral stalk connecting F₁ and F₀ regions of the ATP synthase complex .

What expression systems are most effective for producing recombinant S. woodyi ATP synthase subunit b?

While the search results don't specifically address expression systems for S. woodyi ATP synthase subunit b, successful approaches can be inferred from related research. E. coli-based expression systems have proven effective for other bacterial ATP synthase components, as evidenced by studies on Bacillus PS3 ATP synthase expressed in E. coli . For optimal expression of membrane proteins like ATP synthase subunit b, specialized E. coli strains such as C41(DE3) or C43(DE3) are recommended due to their tolerance for potentially toxic membrane proteins. Expression vectors featuring tunable promoters (like the T7-lac system) allow for controlled expression rates, which is critical for proper folding of membrane-associated proteins. Fusion tags may improve solubility and facilitate purification, though careful consideration must be given to tag removal strategies to ensure native protein function is maintained. Expression temperature typically needs optimization, with lower temperatures (16-25°C) often yielding better results for complex proteins by slowing folding and reducing inclusion body formation.

How can one effectively reconstitute the functional interaction between S. woodyi ATP synthase subunits a and b in vitro?

Reconstituting functional interactions between ATP synthase subunits requires sophisticated methodological approaches. Based on structural studies of bacterial ATP synthases, the interaction between subunits a and b is critical for proton translocation and ATP synthesis . For in vitro reconstitution of S. woodyi ATP synthase components, researchers should consider:

• Co-expression strategy: Similar to the successful approach used with ardA and ardB genes in S. woodyi (where both genes needed co-expression for functional activity) , co-expression of atpF (b subunit) with atpB (a subunit) may be necessary to obtain proper subunit interactions.

• Liposome reconstitution methodology: Purified subunits should be incorporated into liposomes composed of bacterial phospholipids (ideally extracted from Shewanella or similar marine bacteria) using detergent-mediated reconstitution followed by detergent removal via Bio-Beads or dialysis.

• Functional assessment: Proton pumping activity can be measured using pH-sensitive fluorescent dyes (ACMA or pyranine) to monitor proton translocation across the liposomal membrane when an artificial proton gradient is established.

A critical consideration is maintaining the native 1:2 stoichiometry between subunits a and b, as structural studies of bacterial ATP synthases indicate two copies of subunit b interact with one copy of subunit a in the functional complex .

What approaches can resolve contradictory data regarding the orientation and topology of S. woodyi ATP synthase subunit b in the membrane?

Resolving topological contradictions requires multiple complementary techniques:

• Cysteine scanning mutagenesis: Systematically introduce cysteine residues throughout the protein sequence and assess their accessibility to membrane-impermeable sulfhydryl reagents from either side of the membrane. This can definitively map transmembrane segments and their orientation.

• Fusion reporter systems: Construct hybrid proteins with reporter domains (PhoA/LacZ) at various positions to determine cytoplasmic vs. periplasmic exposure based on reporter activity.

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify solvent-exposed regions versus membrane-protected domains with high resolution.

• Cryo-EM analysis: As demonstrated with Bacillus PS3 ATP synthase , high-resolution cryo-EM can resolve the membrane topology of ATP synthase components, particularly when focused refinement is applied to the membrane-embedded regions.

• Cross-linking analysis: Chemical cross-linking coupled with mass spectrometry can identify proximity relationships between subunit b and neighboring subunits, helping to validate structural models.

When comparing contradictory results from different approaches, researchers should consider membrane composition differences, detergent effects, and potential conformational changes during ATP synthase operation. The transmembrane domains predicted from the S. woodyi ATP synthase subunit b sequence (amino acids approximately 10-30) should be experimentally verified using these complementary approaches.

How does the ATP synthase b subunit contribute to S. woodyi's adaptation to its marine environment?

S. woodyi, as a marine bacterium, has evolved specific adaptations for its ecological niche. The ATP synthase b subunit likely plays crucial roles in these adaptations:

• Salt tolerance mechanisms: The amino acid composition of S. woodyi ATP synthase subunit b may contain adaptations for function in high-salt environments. Comparative analysis with non-marine bacterial homologs could reveal substitutions that enhance stability under marine conditions.

• Cold adaptation: As a marine bacterium, S. woodyi likely experiences colder temperatures than many model organisms. The ATP synthase complex may contain structural adaptations for maintaining flexibility and function at lower temperatures.

• Integration with anaerobic respiration: S. woodyi possesses specialized anaerobic respiratory chains, including the recently identified acrylate reductase (ArdAB) system . The ATP synthase complex must functionally integrate with these alternative respiratory pathways, potentially requiring specific adaptations in the b subunit's structure or regulation.

• Pressure adaptations: Marine environments often involve significant hydrostatic pressure, which could influence the structural stability of membrane protein complexes like ATP synthase.

Genomic comparison approaches, as highlighted in the Genomic Science Program's work with multiple Shewanella strains , provide valuable insights into how ATP synthase components have evolved across Shewanella species inhabiting different environments. Experimental approaches comparing the stability and function of S. woodyi ATP synthase b subunit under varying salinity, temperature, and pressure conditions would further illuminate these adaptations.

What methodological approaches are most effective for studying protein-protein interactions involving S. woodyi ATP synthase subunit b?

Several complementary approaches should be employed to comprehensively characterize protein-protein interactions involving the ATP synthase b subunit:

• Cross-linking coupled with mass spectrometry: Chemical cross-linking agents with varying spacer lengths can capture dynamic interactions between subunit b and partner proteins. Mass spectrometry analysis of cross-linked peptides provides precise identification of interaction interfaces.

• Fluorescence resonance energy transfer (FRET): By tagging subunit b and potential interaction partners with appropriate fluorophores, FRET can detect proximity and conformational changes during ATP synthase operation.

• Surface plasmon resonance (SPR): This technique enables quantitative measurement of binding affinities and kinetics between purified subunit b and other ATP synthase components.

• Bacterial two-hybrid systems: Modified for membrane proteins, these genetic screens can identify novel interaction partners in vivo.

• Co-immunoprecipitation with targeted antibodies: Developing specific antibodies against S. woodyi ATP synthase subunit b enables pull-down of intact complexes for proteomic analysis.

Particular attention should be paid to interactions between subunit b and other ATP synthase components, especially subunit δ (equivalent to OSCP in mitochondrial ATP synthase) , as this interaction forms a crucial connection between the F₁ and F₀ sectors. Quantitative assessment of binding affinities under different physiological conditions (pH, ionic strength) can provide insights into how ATP synthase assembly might be regulated in response to environmental changes.

What is the optimal protocol for purifying recombinant S. woodyi ATP synthase subunit b while maintaining its native conformation?

Purification of membrane proteins like ATP synthase subunit b requires specialized protocols to maintain native structure:

• Membrane isolation: Begin with gentle cell lysis (preferably using a French press or sonication under controlled conditions), followed by differential centrifugation to isolate membrane fractions.

• Detergent screening: Test multiple detergents (DDM, LMNG, LDAO) at various concentrations to identify optimal solubilization conditions. A detergent screen comparing protein stability and monodispersity using size-exclusion chromatography is recommended.

• Affinity purification: Based on the tag used during recombinant expression , design an appropriate affinity purification strategy. For membrane proteins, consider using larger beads with wider pores and longer binding times.

• Buffer optimization: The protein should be maintained in a Tris-based buffer with glycerol as indicated in the product specifications . Consider adding cardiolipin or other bacterial phospholipids to stabilize the native conformation.

• Size-exclusion chromatography: As a final purification step to ensure homogeneity and remove aggregates.

The purification success should be validated not just by SDS-PAGE, but also by circular dichroism to confirm secondary structure content and thermal stability assays to assess protein folding. Since ATP synthase subunit b typically forms dimers in the native complex , analytical ultracentrifugation can confirm the oligomeric state of the purified protein.

How can researchers effectively design experiments to study the role of S. woodyi ATP synthase subunit b in proton translocation?

Proton translocation studies require specialized experimental setups:

• Reconstitution system design: Purified subunit b should be co-reconstituted with subunit a and the c-ring into liposomes. The protein:lipid ratio will need optimization, typically starting around 1:50-1:100 (w/w).

• Proton flux measurement methods:

  • pH electrode-based measurements: Monitor bulk pH changes in weakly buffered solutions

  • Fluorescent probe approaches: Use pH-sensitive fluorophores like ACMA or pyranine entrapped in liposomes

  • Patch-clamp electrophysiology: For single-channel measurements if suitable membrane preparations can be achieved

• Site-directed mutagenesis strategy: Based on sequence alignment with well-studied bacterial b subunits, design mutations of key residues at the interface with subunit a. A comprehensive alanine scanning approach focusing on charged and polar residues in the transmembrane regions would identify critical residues.

• Controls and validation:

  • Positive controls using well-characterized ATP synthase components from model organisms

  • Negative controls using liposomes without protein or with irrelevant membrane proteins

  • Inhibitor studies using specific ATP synthase inhibitors (oligomycin, DCCD) to confirm specificity

What analytical techniques are most informative for characterizing conformational changes in S. woodyi ATP synthase subunit b during enzyme function?

Conformational dynamics analysis requires sophisticated biophysical techniques:

• Time-resolved fluorescence spectroscopy: Strategic placement of fluorescent labels at key positions in subunit b can track conformational changes during ATP synthesis/hydrolysis. Particularly informative are FRET pairs positioned to monitor distance changes between the membrane and stalk regions.

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique provides region-specific information about conformational flexibility and solvent accessibility changes under different functional states (e.g., in the presence of ATP, ADP, or proton gradients).

• Single-molecule FRET: For capturing transient conformational states not detectable in ensemble measurements. This is particularly valuable for observing potential asymmetric behaviors in the b-dimer during rotational catalysis.

• Electron paramagnetic resonance (EPR) spectroscopy: Site-directed spin labeling at strategic positions can provide detailed information about local conformational changes and dynamics at the nanosecond to microsecond timescale.

• Cryo-EM in multiple functional states: As demonstrated with Bacillus PS3 ATP synthase , capturing multiple rotational states can reveal conformational changes throughout the complex, including the b subunit.

A potential experimental design would combine strategic labeling of the S. woodyi ATP synthase b subunit with simultaneous functional measurements (ATP synthesis rates or proton pumping) to correlate conformational dynamics with catalytic activity. Comparison of data obtained under different conditions (ATP synthesis vs. hydrolysis directions) would be particularly informative for understanding how conformational changes in subunit b might contribute to the complex's unidirectional preference observed in some bacterial ATP synthases .

How should researchers interpret discrepancies between in vitro and in vivo studies of S. woodyi ATP synthase subunit b function?

Reconciling discrepancies between in vitro and in vivo results requires systematic analysis:

• Environmental difference assessment: Marine bacteria like S. woodyi experience unique conditions (salinity, pressure, temperature) that may not be adequately replicated in standard laboratory conditions . Researchers should document all differences between in vitro experimental conditions and the native environment.

• Protein-lipid interaction considerations: The native lipid composition of S. woodyi membranes likely differs significantly from model systems. Consider how these differences might affect:

  • Protein folding and stability

  • Lateral organization within membranes

  • Functional interactions with other components

• Analytical framework for reconciliation:

  Factor	In Vitro Assessment	In Vivo Reality	Potential Impact
  Lipid environment	Defined, simplified	Complex, native	Altered conformational dynamics
  Protein partners	Isolated or partial complexes	Complete interactome	Missing regulatory interactions
  Redox environment	Controlled, often aerobic	Variable, often anaerobic	Modified activity and stability
  Ion concentrations	Standardized buffers	Dynamic, specialized	Changed electrostatic interactions

• Methodological approaches for resolution:

  • Develop more native-like in vitro systems incorporating S. woodyi lipid extracts

  • Perform in-cell spectroscopic or imaging studies when possible

  • Use genetic approaches (complementation studies) to validate in vitro findings

When examining contradictory results, researchers should consider that S. woodyi, like other Shewanella species, demonstrates complex respiratory adaptations that may influence ATP synthase function in ways not captured by standard in vitro reconstitution systems.

What computational approaches provide the most insight into structure-function relationships of S. woodyi ATP synthase subunit b?

Multiple computational methods should be integrated for comprehensive analysis:

• Homology modeling with template selection strategy:

  • Primary templates should come from bacterial ATP synthases with solved structures

  • Secondary validation using evolutionary coupling data

  • Special attention to transmembrane regions where sequence conservation may be lower

• Molecular dynamics simulations:

  • Implement specialized membrane simulation parameters

  • Long timescale simulations (>500 ns) to capture conformational dynamics

  • Coarse-grained models for larger-scale movements followed by all-atom refinement

• Evolutionary analysis approaches:

  • Comparative analysis across the 16+ sequenced Shewanella species

  • Identification of conserved vs. variable regions specific to marine vs. non-marine species

  • Co-evolutionary analysis to detect residue pairs likely to interact functionally

• Integration with experimental data:

  • Use distance constraints from cross-linking or spectroscopic data to refine models

  • Validate predictions with site-directed mutagenesis

  • Iterative refinement as new structural data becomes available

The optimal computational workflow would begin with sequence-based analysis across multiple Shewanella species to identify conserved features, followed by structural modeling informed by available ATP synthase structures , and finally dynamic simulations to predict functional behaviors under different conditions. Particular attention should be paid to the interface between subunit b and other components of the ATP synthase complex, as these interaction surfaces often contain functionally critical residues.

How can researchers differentiate between the specific roles of ATP synthase subunits a and b in S. woodyi energy metabolism?

Discriminating between the functions of these closely associated subunits requires precise experimental design:

• Gene-specific knockout/complementation strategy:

  • Generate individual atpB and atpF deletion mutants in S. woodyi

  • Create complementation strains with controlled expression

  • Assess phenotypic differences in growth rates, ATP production, and membrane potential

• Subunit-specific inhibition approaches:

  • Design peptides mimicking interaction surfaces specific to each subunit

  • Develop antibodies with demonstrated subunit specificity

  • Test natural products with preferential binding to one subunit

• Analytical method for functional distinction:

  Function	Subunit a (atpB) Role	Subunit b (atpF) Role	Experimental Approach
  Proton channel formation	Primary contribution	Minimal/structural	Site-directed mutagenesis of charged residues
  Complex stability	Membrane anchor	Peripheral stalk formation	Cross-linking studies with varying cross-linker lengths
  Regulatory interactions	Limited	Extensive with F₁ sector	Pull-down assays with truncated constructs

• Chimeric protein approach: Exchange domains between S. woodyi ATP synthase subunits a and b with corresponding regions from well-characterized bacterial homologs to map function-specific domains.

Researchers should also consider the potential for specialized adaptations in S. woodyi related to its marine environment and capacity for anaerobic respiration through multiple electron acceptors . The relationship between ATP synthase function and other respiratory complexes, such as the recently characterized acrylate reductase system , may reveal unique roles for subunits a and b in coordinating energy metabolism under different environmental conditions.

How might the study of S. woodyi ATP synthase contribute to our understanding of bacterial adaptation to extreme environments?

S. woodyi's ATP synthase offers unique insights into environmental adaptation:

• Marine environment adaptation mechanisms:

  • Analysis of amino acid composition of ATP synthase subunit b for salt-tolerance adaptations

  • Comparison with terrestrial Shewanella species to identify marine-specific sequence motifs

  • Functional studies under varying salinity conditions to assess operational flexibility

• Integration with specialized respiratory systems:

  • S. woodyi possesses unique anaerobic respiratory capabilities, including the recently identified acrylate reductase system (ArdAB)

  • Investigation of how ATP synthase components might be optimized to function with these specialized electron transport chains

  • Assessment of regulatory connections between ATP synthase gene expression and respiratory chain components

• Evolutionary adaptation signatures:

  • Comparative genomic analysis across the 16+ Shewanella strains focusing on ATP synthase components

  • Identification of selection signatures in marine vs. non-marine species

  • Reconstruction of the evolutionary trajectory of ATP synthase adaptation

This research direction extends beyond S. woodyi to broader questions of how essential energy conservation mechanisms adapt to environmental constraints. Findings could provide insights relevant to other extremophiles and contribute to our understanding of the molecular basis of bacterial adaptation to challenging habitats.

What methodologies show promise for exploring potential biotechnological applications of S. woodyi ATP synthase components?

Several innovative approaches have potential for biotechnological applications:

• Nanobiotechnology applications:

  • ATP synthase components as nanomotors or molecular switches

  • Integration into artificial membrane systems for energy harvesting

  • Development of sensors based on conformational changes in subunit b

• Bioengineering methodologies:

  • Creation of chimeric ATP synthases with enhanced stability or altered specificity

  • Engineering salt-tolerance features from S. woodyi ATP synthase into industrial enzymes

  • Development of expression systems optimized for membrane protein production

• Experimental design approaches for application development:

  Application	Key ATP Synthase Feature	Methodological Approach
  Biosensors	Conformational sensitivity to proton gradient	Site-specific fluorescent labeling coupled with immobilization strategies
  Biomimetic energy systems	Rotary catalysis mechanism	Reconstitution in synthetic polymer membranes with enhanced durability
  Protein stabilization	Marine adaptation elements	Domain grafting into industrially relevant enzymes

• Integration with synthetic biology frameworks:

  • Creation of minimal ATP synthase models based on essential features identified in S. woodyi

  • Development of orthogonal energy conservation systems for synthetic cells

  • Engineering of regulatory circuits connecting ATP synthase operation to synthetic cellular processes

The unique properties of ATP synthase components from extremophiles like S. woodyi provide valuable starting points for protein engineering efforts aimed at creating biomolecular machines with enhanced stability or novel functions. Collaborative approaches combining structural biology, protein engineering, and materials science offer particularly promising avenues for translating fundamental knowledge into biotechnological applications.

How can systems biology approaches enhance our understanding of S. woodyi ATP synthase in the context of cellular energy networks?

Integrative systems biology offers powerful frameworks for contextualizing ATP synthase function:

• Multi-omics integration strategies:

  • Correlative analysis of transcriptomics, proteomics, and metabolomics data under varying energy conditions

  • Network reconstruction to identify regulatory connections between ATP synthase components and other cellular systems

  • Flux balance analysis to quantify energy partition under different growth conditions

• Computational modeling approaches:

  • Kinetic modeling of the complete ATP synthase in the context of electron transport chains

  • Agent-based modeling of ATP synthase distribution and activity in membranes

  • Whole-cell modeling incorporating ATP synthase as a central energy conversion module

• Experimental validation methodologies:

  • CRISPR interference for titratable repression of ATP synthase components

  • Metabolic flux analysis using isotope labeling

  • Single-cell imaging of energy dynamics using fluorescent reporters

• Integration with ecological context:

  • Linking genomic features with environmental parameters

  • Modeling ATP synthase performance under fluctuating conditions typical of marine environments

  • Comparative analysis across multiple Shewanella species adapted to different niches

A systems biology approach would be particularly valuable for understanding how S. woodyi coordinates its diverse respiratory capabilities with ATP synthesis under different environmental conditions. This might reveal previously unrecognized regulatory mechanisms and help explain how bacteria optimize energy conservation in challenging environments.

What are the most significant unresolved questions about S. woodyi ATP synthase subunit b that should guide future research?

Key unresolved questions that merit further investigation include:

• Structural uniqueness: How do the structural features of S. woodyi ATP synthase subunit b differ from those of model organisms, and what functional implications do these differences have?

• Environmental adaptation: What specific molecular adaptations in subunit b enable S. woodyi ATP synthase to function optimally in marine environments?

• Integration with specialized metabolism: How does ATP synthase function coordinate with S. woodyi's unique respiratory capabilities, including the recently characterized acrylate reductase system ?

• Regulatory mechanisms: What transcriptional, translational, or post-translational regulatory systems control ATP synthase assembly and activity in response to environmental changes?

• Evolutionary trajectory: How has the ATP synthase complex evolved across Shewanella species, and what can this tell us about bacterial adaptation to diverse environments?