Recombinant Shewanella woodyi Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant plsY is produced in E. coli (full-length) or mammalian cells (partial), with purification via affinity chromatography (His-tag) . Key protocols include:

  • Reconstitution: Lyophilized protein dissolved in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Storage: -20°C/-80°C for long-term use; avoid repeated freeze-thaw cycles .

Catalytic Properties and Substrate Specificity

plsY transfers acyl groups from acyl-ACP/CoA to G3P. While direct studies on S. woodyi plsY are sparse, related Shewanella enzymes (e.g., PlsC) exhibit:

  • Substrate Preference: Selectivity for polyunsaturated fatty acids (e.g., eicosapentaenoyl groups) .

  • Reaction Mechanism: Acylation at the sn-1 position, distinct from plant GPATs that acylate sn-2 .

Substrate TypeSource EnzymePreferenceReference
Acyl-ACP/CoAS. livingstonensis PlsCPolyunsaturated fatty acids
Glycerol-3-phosphateSquash G3PATOleate (C18:1) vs. palmitate (C16:0)

Key Findings

  • Structural Adaptations: Hydrophobic clefts and conserved motifs (H(X)₄D) mediate acyl binding and catalysis .

  • Membrane Lipid Synthesis: Critical for phosphatidic acid production, a precursor for membrane phospholipids .

  • Ecological Relevance: Shewanella spp. utilize plsY in carbohydrate catabolism and adaptive lipid metabolism .

Applications

  • Lipid Bioengineering: Engineering plsY for enhanced polyunsaturated fatty acid incorporation in biofuels or nutraceuticals .

  • Membrane Biophysics: Studying lipid composition impacts on bacterial membrane stability .

Challenges and Future Directions

  • Structural Limitations: No crystal structure for S. woodyi plsY; reliance on homologs (e.g., squash G3PAT) .

  • Functional Gaps: Kinetic parameters (e.g., Kₘ, Vₘₐₓ) and pH/temperature optima remain uncharacterized.

  • Methodological Advances: Utilizing detergents like 6-cyclohexyl-1-hexyl-β-d-maltoside to solubilize active plsY .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
plsY; Swoo_1158; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Shewanella woodyi (strain ATCC 51908 / MS32)
Target Names
plsY
Target Protein Sequence
MTITALTLGMILSAYLAGSISSAVLVCRLRGLPDPRTQGSGNPGATNVLRIGGVSSAALV LFFDMLKGALPAYIAFRLGLDSVSLGIIAIAACLGHIFPIFFHFKGGKGVATAFGAMAPI GPELALLLMGSWVLMVLICRYSSLAAIVTALLAPFYTWYLDDRFVLPVAMLSALIIIRHK ENIQRLLKGEESKFSRKKTPKT
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), yielding lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its role in bacterial phospholipid biosynthesis?

Glycerol-3-phosphate acyltransferase (plsY) belongs to a family of bacterial acyltransferases that play a crucial role in membrane phospholipid biosynthesis. PlsY catalyzes the transfer of an acyl group from acylphosphate to glycerol-3-phosphate, representing a key step in the initiation of phosphatidic acid formation in bacterial membrane phospholipid biosynthesis . This reaction is part of the most widely distributed biosynthetic pathway for phospholipids in bacteria.

The pathway involves:

  • Conversion of acyl-acyl carrier protein to acylphosphate by PlsX

  • Transfer of the acyl group from acylphosphate to glycerol-3-phosphate by PlsY

  • Subsequent formation of phosphatidic acid, which serves as a precursor for various membrane glycerophospholipids

In Shewanella species, including S. woodyi, this enzyme is integral to membrane biogenesis and adaptation to various environmental conditions.

How does plsY differ structurally from other acyltransferases?

PlsY possesses distinct structural features that differentiate it from other acyltransferases:

  • Membrane topology: Studies on Streptococcus pneumoniae PlsY revealed five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane

  • Three conserved cytoplasmic domains: Each containing highly conserved sequence motifs critical for catalytic activity

  • Specific active site architecture:

    • Motif 1: Contains essential serine and arginine residues

    • Motif 2: Functions as a phosphate-binding loop crucial for glycerol-3-phosphate binding

    • Motif 3: Contains conserved histidine and asparagine important for activity, plus a glutamate critical to structural integrity

These structural features distinguish PlsY from PlsC (1-acyl-sn-glycerol-3-phosphate acyltransferase), another bacterial acyltransferase involved in phospholipid biosynthesis but with different substrate preferences and structural characteristics .

What are the optimal storage conditions for recombinant Shewanella plsY preparations?

Based on information from related recombinant Shewanella proteins:

  • Liquid form: Store at -20°C/-80°C with a typical shelf life of approximately 6 months

  • Lyophilized form: Store at -20°C/-80°C with an extended shelf life of approximately 12 months

  • Working aliquots: Store at 4°C for no more than one week

  • Avoid repeated freeze-thaw cycles as this can compromise enzyme activity

For reconstitution:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage (50% is typically recommended)

How should researchers design controlled experiments to determine optimal pH and temperature for S. woodyi plsY activity?

When designing experiments to determine optimal pH and temperature for S. woodyi plsY activity, follow these methodological steps:

  • Clearly state your hypothesis

    • Example: "S. woodyi plsY exhibits maximum activity at pH 7.5 and 20°C, reflecting its marine environment adaptation"

  • Identify and control variables:

    • Independent variables: pH or temperature (test one variable at a time)

    • Dependent variable: Enzyme activity (measured using appropriate assays)

    • Control variables: Substrate concentration, enzyme concentration, buffer composition, reaction time4

  • Experimental setup for temperature optimization:

    • Prepare identical reaction mixtures containing purified enzyme, substrate, and buffer

    • Incubate at different temperatures (range 0-40°C is recommended for marine bacteria)

    • Measure activity at each temperature under otherwise identical conditions

    • Plot enzyme activity vs. temperature to identify the optimum4

  • Experimental setup for pH optimization:

    • Prepare identical reaction mixtures using a series of buffers covering the pH range 5.0-9.0

    • Ensure buffer components don't interfere with the enzyme assay

    • Maintain constant temperature (preferably at the optimum determined previously)

    • Plot enzyme activity vs. pH to identify the optimum4

  • Controls and considerations:

    • Include enzyme-free controls at each pH and temperature

    • Account for potential buffer effects on enzyme stability

    • Consider using buffer systems with overlapping pH ranges to confirm results aren't buffer-dependent4

What purification methods are most effective for isolating recombinant S. woodyi plsY while maintaining its activity?

Purifying membrane-bound acyltransferases like plsY presents significant challenges due to their integral membrane nature. Based on successful purification of related enzymes:

  • Expression system selection:

    • Heterologous expression in E. coli with appropriate affinity tags

    • Consider using yeast expression systems, which have proven successful for other Shewanella proteins

  • Solubilization strategies:

    • Critical step: Use appropriate detergents that maintain enzyme activity

    • Recent success with 1-acyl-sn-glycerol-3-phosphate acyltransferase (PlsC) from Shewanella livingstonensis Ac10 was achieved using 6-cyclohexyl-1-hexyl-β-d-maltoside as the detergent

    • Alternative detergents to consider: n-dodecyl-β-D-maltoside (DDM) or digitonin

  • Purification protocol:

    • Cell disruption: French press or sonication in buffer containing protease inhibitors

    • Membrane fraction isolation: Differential centrifugation

    • Membrane protein solubilization: Incubation with selected detergent (critical concentration determination required)

    • Affinity chromatography: Using appropriate affinity tags (His-tag is commonly used)

    • Size exclusion chromatography: For further purification and detergent exchange if needed

  • Activity preservation considerations:

    • Maintain cold temperatures throughout purification

    • Include glycerol (10-20%) in all buffers

    • Consider adding phospholipids to stabilize the enzyme

    • Verify activity at each purification step

How can researchers effectively measure plsY enzyme activity in vitro?

Measuring plsY activity requires specialized assays that monitor the transfer of acyl groups to glycerol-3-phosphate:

  • Direct activity assay:

    • Substrate preparation: Acylphosphate and glycerol-3-phosphate

    • Detection method: Measure the formation of 1-acyl-glycerol-3-phosphate (lysophosphatidic acid)

    • Analytical techniques: HPLC, mass spectrometry, or thin-layer chromatography

    • Quantification: Compare against standard curves of authentic lysophosphatidic acid

  • Spectrophotometric coupled assays:

    • Principle: Couple plsY reaction to another enzyme reaction that generates a spectrophotometrically detectable product

    • Example: Couple release of inorganic phosphate to colorimetric phosphate detection methods

    • Monitoring: Continuous measurement at appropriate wavelength (typically 340-450nm depending on the coupled system)

  • Radioactive substrate assay:

    • Substrates: [14C] or [3H]-labeled acyl donors

    • Procedure: Incubate enzyme with labeled substrate and separate products by TLC

    • Detection: Autoradiography or scintillation counting of isolated products

    • Advantage: High sensitivity for low activity detection

  • Controls and considerations:

    • Enzyme-free controls to account for spontaneous reactions

    • Heat-inactivated enzyme controls

    • Substrate competition assays to confirm specificity

    • Time-course experiments to establish linear range of activity4

How does S. woodyi plsY substrate specificity compare to plsY enzymes from other bacterial species?

Substrate specificity of bacterial plsY enzymes varies significantly between species, reflecting their evolutionary adaptations to different environments:

  • Acyl chain specificity:

    • S. woodyi likely exhibits preferences related to its marine environment

    • By comparison, other Shewanella species like S. livingstonensis show substrate preferences for acyl donors with polyunsaturated fatty acyl groups, such as eicosapentaenoyl groups

    • This contrasts with S. pneumoniae PlsY, which is noncompetitively inhibited by palmitoyl-CoA

  • Comparative substrate preference table:

Bacterial SpeciesPreferred Acyl DonorsEnvironmental Adaptation
S. livingstonensisPolyunsaturated fatty acyl groups (e.g., eicosapentaenoyl)Cold marine environment
S. pneumoniaeSaturated and monounsaturated acyl groupsHuman host environment
S. woodyiLikely preference for medium-chain acyl groups*Marine environment, bioluminescent

*Predicted based on ecological niche; requires experimental confirmation

  • Structural basis for specificity:

    • Variations in the acyl-binding pocket composition

    • Differences in the glycerol-3-phosphate binding site (Motif 2)

    • Potential evolutionary adaptations related to membrane fluidity requirements in different environments

What site-directed mutagenesis strategies would be most informative for studying S. woodyi plsY structure-function relationships?

Based on structural studies of PlsY from S. pneumoniae, several targeted mutagenesis approaches would yield valuable insights:

  • Catalytic domain mutations:

    • Motif 1: Target conserved serine and arginine residues shown to be essential for catalysis in S. pneumoniae PlsY

    • Experimental approach: Create S→A and R→K/A substitutions and assess impact on activity

  • Substrate binding site mutations:

    • Motif 2: Target glycines within the phosphate-binding loop that affect glycerol-3-phosphate binding

    • Experimental design: Create G→A substitutions and determine effects on Km for glycerol-3-phosphate

  • Structural integrity mutations:

    • Motif 3: Target conserved histidine, asparagine, and glutamate residues

    • Special focus on glutamate shown to be critical for structural integrity in other PlsY enzymes

  • Transmembrane domain mutations:

    • Target residues within the five membrane-spanning segments to assess their role in membrane integration and enzyme stability

    • Apply substituted cysteine accessibility method (SCAM) to probe membrane topology

  • Experimental validation approaches:

    • Express mutant proteins and assess:

      • Expression levels (Western blotting)

      • Membrane integration (fractionation studies)

      • Enzyme activity (using assays described in section 2.3)

      • Substrate binding affinities (kinetic analyses)

      • Protein stability (thermal shift assays)

How might S. woodyi's bioluminescence and metal tolerance capabilities influence plsY function and experimental design considerations?

S. woodyi has unique physiological characteristics that may influence plsY function and experimental approaches:

  • Bioluminescence considerations:

    • S. woodyi emits luminescence in both planktonic and sessile conditions

    • This bioluminescence is regulated by quorum sensing through N-octanoyl-L-homoserine lactone (C8-HSL)

    • Research implications:

      • Potential cross-talk between membrane lipid composition and bioluminescence pathways

      • Possible influence of cell density on plsY expression levels

      • Experimental design should account for growth phase and quorum sensing effects

  • Metal tolerance characteristics:

    • S. woodyi displays "unprecedented tolerance for Zn(II)"

    • Shows tolerance for electric potentials and various heavy metals in biofilm states

    • Research implications:

      • Metal ions may influence plsY activity through direct or indirect mechanisms

      • Experimental buffers should be carefully formulated to control metal ion concentrations

      • Potential for metal ions to serve as cofactors or inhibitors for plsY

  • Experimental design modifications:

    • Include controls for cell density and growth phase when studying native plsY expression

    • Consider the impact of biofilm formation on membrane lipid composition and plsY activity

    • Test enzyme activity in the presence of various metal ions to identify potential regulators

    • Account for the marine origin of S. woodyi when designing buffer systems (salinity, pH)

What are common challenges in recombinant expression of S. woodyi plsY and how can they be addressed?

Membrane proteins like plsY present specific challenges in recombinant expression:

  • Low expression levels:

    • Challenge: Integral membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for expression host

      • Use strong inducible promoters with tight regulation

      • Test multiple expression strains and conditions

      • Consider lower induction temperatures (16-20°C) for longer periods

  • Protein misfolding and inclusion body formation:

    • Challenge: Overexpressed membrane proteins often aggregate

    • Solutions:

      • Reduce expression rate by lowering inducer concentration

      • Co-express with molecular chaperones

      • Use fusion tags that enhance solubility (MBP, SUMO, etc.)

      • Develop refolding protocols if inclusion bodies are unavoidable

  • Toxicity to host cells:

    • Challenge: Membrane protein overexpression can disrupt host cell membrane integrity

    • Solutions:

      • Use tightly regulated expression systems

      • Test expression in specialized strains (C41/C43 for E. coli)

      • Use lower copy number plasmids

      • Consider yeast or insect cell expression systems as alternatives

  • Loss of activity during purification:

    • Challenge: Maintaining enzyme activity during extraction from membranes

    • Solution: Screen multiple detergents systematically, starting with milder options

How can researchers optimize experimental conditions for studying S. woodyi plsY in complex environmental contexts?

When studying S. woodyi plsY in environmentally relevant conditions:

  • Media composition considerations:

    • Use marine broth or defined marine media to mimic natural environment

    • Consider carbon source effects on expression and activity

    • Account for metal ion concentrations, particularly zinc given S. woodyi's metal tolerance

  • Biofilm vs. planktonic states:

    • S. woodyi forms biofilms with different physiological characteristics than planktonic cells

    • Methodological approach:

      • Grow biofilms on appropriate surfaces (glass, plastic, marine-relevant substrates)

      • Extract and analyze membrane lipids from both growth states

      • Compare plsY expression and activity between states

  • Luminescence interactions:

    • Account for luminescence state in experimental design

    • Consider potential regulatory cross-talk between luminescence genes and lipid metabolism

    • Methodology: Use swoI and swoR mutants (non-luminescent) to study potential effects of luminescence on plsY

  • Data collection and analysis considerations:

    • Ensure appropriate controls for each environmental variable

    • Account for potential confounding factors in complex media

    • Design factorial experiments to identify interaction effects between variables

    • Use statistical methods appropriate for complex experimental designs4

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.