Recombinant Shewanella woodyi Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction

Lipoprotein signal peptidase (LspA) is an aspartyl protease that cleaves the transmembrane helix signal peptide of lipoproteins as part of the lipoprotein-processing pathway . This enzyme is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria, making it an excellent target for antibiotic therapeutics because it may not develop antibiotic resistance .

Shewanella woodyi is a marine bacterium known for anaerobic respiration using organic compounds as terminal acceptors in the electron transport chain . The sequenced genome of S. woodyi MS32 contains genes coding for acylhomoserine lactone (AHL) and autoinducer-2 (AI-2) quorum sensing (QS) systems .

Structure and Function

LspA, also known as prolipoprotein signal peptidase or signal peptidase II (SPase II), catalyzes the removal of signal peptides from prolipoproteins . Lipoproteins constitute 2 to 3% of bacterial genomes and play critical roles in bacterial physiology, pathogenicity, and antibiotic resistance, with functions ranging from cell envelope structure to signal transduction and transport . Lipoproteins are synthesized with a signal peptide that secures them to the cytoplasmic membrane, with the lipoprotein domain in the periplasm or outside the cell . Posttranslational processing requires LspA to remove the signal peptide .

Mechanism of Action

LspA functions as an aspartyl peptidase . The crystal structure of LspA from Pseudomonas aeruginosa complexed with the antimicrobial globomycin reveals that globomycin inhibits by acting as a noncleavable peptide that sterically blocks the active site in an example of molecular mimicry .

The functional conformational dynamics of LspA facilitate an equilibrium of states hypothesized to be important for antibiotic and substrate binding as well as enzymatic activity . The apo protein fluctuates between an open conformation required for substrate binding and a closed state that occludes active site residues from the hydrophobic membrane . The antibiotic globomycin stabilizes an intermediate conformation that inhibits signal peptide cleavage and substrate binding .

Conformational Dynamics

The periplasmic helix of LspA fluctuates on the nanosecond timescale and samples unique conformations in different states . In the apo state, the dominant conformation is the most closed, occluding the charged active site from the lipid bilayer . With antibiotic bound, there are multiple binding modes with the dominant conformation of the periplasmic helix in a more open conformation . These different conformations observed in both bound and apo states indicate a flexible and adaptable active site, which explains how LspA accommodates and processes such a variety of substrates .

Using crystal structures, molecular dynamics (MD) simulations, and electron paramagnetic resonance (EPR), the plasticity of antibiotic binding and the conformation states of LspA are identified, providing a better understanding of how therapeutics could inhibit this essential bacterial enzyme .

Role in Anaerobic Respiration

Shewanella woodyi can use different organic compounds as terminal acceptors in the electron transport chain during anaerobic respiration . Acrylate reductase activity in S. woodyi copurifies with an ArdA protein (Swoo_0275) . The co-expression of ardA with ardB genes encodes flavocytochrome c ArdAB, responsible for acrylate reduction in S. woodyi cells . ArdAB is highly specific for acrylate as a substrate and reduces only methacrylate at a lower rate . Acrylate and methacrylate induce ardA gene expression in S. woodyi under anaerobic conditions, accompanied by periplasmic acrylate reductase activity . ArdAB-linked acrylate reduction supports dimethylsulfoniopropionate-dependent anaerobic respiration in S. woodyi and possibly other marine bacteria .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please specify them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, and customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
lspA; Swoo_1292; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Shewanella woodyi (strain ATCC 51908 / MS32)
Target Names
lspA
Target Protein Sequence
MPTNWKDSGLRWYWMVVLVFIADQLSKQWVLANFELRESVELLPFFNFTYLRNYGAAFSF LSDAGGWQRWFFTFVAVGFSTLLTIWLRKQPRQMWRLNLAYTLVIGGALGNLIDRLQHGY VVDFLHFYWNTSHFPAFNIADSAICVGAALIIIDSIITERDDKKKKAQENNNTAKE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella woodyi Lipoprotein signal peptidase (lspA) and what is its function?

Shewanella woodyi Lipoprotein signal peptidase (lspA), also known as Signal peptidase II (SPase II), is an aspartyl protease (EC 3.4.23.36) that plays a critical role in the lipoprotein-processing pathway. This enzyme specifically cleaves the transmembrane helix signal peptide of lipoproteins after they have been modified by prolipoprotein diacylglyceryl transferase (Lgt) . The full-length protein consists of 176 amino acids and functions within the bacterial membrane to process lipoproteins that are essential for various cellular functions. LspA is part of a processing pathway that is essential for bacterial viability, particularly in Gram-negative bacteria, and is important for virulence in Gram-positive bacteria .

What is the structural composition of S. woodyi LspA?

S. woodyi LspA (UniProt ID: B1KIT6) has a specific amino acid sequence beginning with MPTNWKDSGLRWYWMVVLVFIADQLSKQ and continuing through 176 amino acids . Structurally, LspA contains multiple transmembrane domains and a periplasmic helix (PH) that exhibits significant conformational flexibility. The enzyme contains a β-cradle structure that, together with the periplasmic helix, forms the active site pocket. Based on molecular dynamics studies of LspA proteins, the enzyme can adopt multiple conformational states, including closed, intermediate, and open conformations, which are critical for its function in recognizing and processing various lipoprotein substrates .

How does LspA activity contribute to bacterial physiology?

LspA's role in processing bacterial lipoproteins is fundamental to bacterial survival. In the lipoprotein maturation pathway, prolipoproteins are first modified by Lgt, which adds a diacylglyceryl moiety to the cysteine residue in the lipobox motif. LspA then cleaves the signal peptide at the modified cysteine, resulting in a mature lipoprotein that can be properly localized to the bacterial membrane . The cleaved lipoproteins perform essential functions including nutrient acquisition, cell division, antibiotic resistance, and interaction with host immune systems. Research demonstrates that LspA function is particularly critical for intracellular growth and virulence, making it an attractive target for antimicrobial development .

What expression systems are optimal for recombinant S. woodyi LspA production?

For optimal expression of recombinant S. woodyi LspA, researchers should consider using specialized expression systems designed for membrane proteins. Escherichia coli expression systems with controlled induction mechanisms are frequently employed, as demonstrated in complementation studies with recombinant LspA from other bacterial species . When expressing S. woodyi LspA, researchers should use vectors containing appropriate affinity tags that do not interfere with protein folding or function. The expression construct should include the complete lspA gene sequence (encoding all 176 amino acids) from S. woodyi strain ATCC 51908 / MS32, with codon optimization for the chosen expression host to enhance protein yield .

What methods are recommended for purifying active S. woodyi LspA?

Purification of active S. woodyi LspA requires specialized protocols for membrane proteins. A recommended approach includes:

  • Membrane fraction isolation using differential centrifugation after cell lysis

  • Solubilization of membrane proteins using mild detergents (such as n-dodecyl-β-D-maltoside or CHAPS)

  • Affinity chromatography utilizing appropriate affinity tags incorporated during recombinant expression

  • Size exclusion chromatography to enhance purity and remove aggregates

  • Detergent exchange or reconstitution into lipid nanodiscs or liposomes to maintain native-like environment

For storage, a Tris-based buffer with 50% glycerol is recommended to maintain stability, and the purified protein should be stored at -20°C for short-term use or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided to preserve enzymatic activity .

How can researchers assess the enzymatic activity of S. woodyi LspA?

The enzymatic activity of S. woodyi LspA can be assessed using several complementary approaches:

  • SDS-PAGE gel-shift assay: This method uses a model substrate such as prepro inhibitor of cysteine protease (ppICP), which is first modified by Lgt using dioleoylphosphatidylglycerol (DOPG) as a lipid substrate. Active LspA then cleaves the signal peptide, resulting in a ~10 kDa molecular weight shift that can be visualized and quantified via SDS-PAGE .

  • Globomycin resistance assay: Functional LspA confers resistance to the antibiotic globomycin. Researchers can express recombinant S. woodyi LspA in a globomycin-sensitive host and measure growth in the presence of increasing globomycin concentrations to indirectly assess LspA activity .

  • Genetic complementation: Temperature-sensitive E. coli strains with defective LspA (such as E. coli Y815) can be used to evaluate functional activity of recombinant S. woodyi LspA by assessing growth restoration at non-permissive temperatures .

  • Fluorescence-based assays: Development of fluorescent substrates containing LspA cleavage sites enables real-time monitoring of enzymatic activity through fluorescence resonance energy transfer (FRET) techniques.

What conformational dynamics are important for S. woodyi LspA function?

S. woodyi LspA, like other LspA proteins, exhibits important conformational dynamics that are crucial for its enzymatic function. Based on molecular dynamics simulations and electron paramagnetic resonance (EPR) studies, LspA exists in an equilibrium between multiple conformational states. The periplasmic helix of LspA fluctuates on the nanosecond timescale and can adopt at least three distinct conformations :

  • Closed conformation: In the apo (unbound) state, the dominant conformation is the most closed, with the periplasmic helix positioned approximately 6.2 Å from the β-cradle, completely occluding the charged active site from the lipid bilayer. This conformation protects the active site in the absence of substrate.

  • Intermediate conformation: This state is stabilized when an antibiotic like globomycin is bound and may also represent a substrate-clamped state.

  • Open conformation: This conformation creates a trigonal cavity where the lipoprotein substrate and its diacylglyceryl moiety can bind. This is the only conformation that sterically accommodates the prolipoprotein substrate for cleavage.

These conformational states facilitate LspA's ability to process a variety of substrates and explain the mechanism of inhibition by antibiotics like globomycin .

What techniques are most effective for studying S. woodyi LspA structural dynamics?

A multi-method approach yields the most comprehensive understanding of S. woodyi LspA structural dynamics:

  • Molecular Dynamics (MD) Simulations: MD simulations provide atomistic details of conformational changes, capturing the nanosecond-scale fluctuations of the periplasmic helix and identifying conformational states not observable in static crystal structures .

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Continuous Wave (CW) EPR reveals the mobility of specific regions within the protein structure

    • Double Electron-Electron Resonance (DEER) EPR measures distance distributions between labeled sites, confirming the presence of multiple conformational populations

  • X-ray Crystallography: Provides high-resolution static structures in different states (apo or inhibitor-bound), serving as starting points for dynamic studies.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifies regions of conformational flexibility by measuring the rate of hydrogen exchange.

  • Single-molecule FRET: Monitors conformational changes in real-time at the single-molecule level.

The combination of these approaches has proven particularly powerful, as "each approach in isolation has its limitations, and only in combination were we able to visualize and map the conformational dynamics" .

How does substrate binding affect the structural dynamics of LspA?

Substrate binding induces significant changes in LspA conformational dynamics. In the apo state, LspA predominantly occupies a closed conformation that occludes the active site. Upon substrate approach, the periplasmic helix transitions to a more open conformation, creating a binding pocket that can accommodate the lipoprotein substrate. The binding event likely stabilizes an intermediate conformation where the active site residues are optimally positioned for catalysis .

The table below summarizes the relationship between LspA conformational states and functional roles:

Conformational StateDistance Between PH and β-cradleFunctional RolePredominant In
Closed~6.2 ÅProtection of active siteApo state
Intermediate~7-10 ÅCatalysis and inhibitor bindingGlobomycin-bound state
Open>10 ÅSubstrate bindingTransiently during substrate approach

This structural plasticity explains how LspA accommodates and processes various lipoprotein substrates despite their sequence diversity .

Why is LspA considered a promising antibiotic target?

LspA represents an attractive target for antibiotic development for several compelling reasons:

  • Essentiality: LspA is essential for the viability of Gram-negative bacteria, making it an indispensable target that bacteria cannot simply bypass .

  • Virulence factor: In Gram-positive bacteria, while not always essential for viability, LspA significantly contributes to virulence, making it relevant for treating pathogenic infections .

  • Conservation and uniqueness: LspA is highly conserved across bacterial species but has no human homolog, minimizing potential off-target effects in humans.

  • Resistance development: The essential nature and conservation of LspA suggest a lower likelihood of developing resistance, as mutations that significantly alter its function would likely be lethal to the bacteria .

  • Proven inhibition: Natural products such as globomycin have demonstrated effective inhibition of LspA, proving the concept that the enzyme is druggable .

  • Membrane location: LspA's location in the bacterial membrane provides accessibility for drug targeting without requiring cellular penetration.

Recent computational design of cyclic peptide inhibitors further demonstrates LspA's viability as a target for novel antimicrobial development .

What mechanisms underlie globomycin inhibition of LspA?

Globomycin is a cyclic peptide natural product that inhibits LspA through a specific mechanism elucidated through structural and functional studies:

  • Competitive inhibition: Globomycin acts as a competitive inhibitor that mimics the substrate binding to the active site of LspA.

  • Conformational stabilization: When bound to LspA, globomycin stabilizes an intermediate conformation of the periplasmic helix that inhibits both signal peptide cleavage and substrate binding .

  • Multiple binding modes: Molecular dynamics simulations and EPR studies reveal that globomycin exhibits multiple binding modes within the LspA active site, with the dominant conformation featuring a more open periplasmic helix compared to the apo state .

  • Active site occlusion: Upon binding, globomycin occupies the active site cavity, preventing access of the natural lipoprotein substrate.

  • Resistance mechanism: Bacteria that develop resistance to globomycin often exhibit mutations that affect globomycin binding while preserving essential LspA catalytic function .

Understanding these mechanisms has informed the design of next-generation LspA inhibitors with improved potency and specificity .

What assays are most effective for screening potential S. woodyi LspA inhibitors?

Researchers have developed several complementary assays for screening potential inhibitors of S. woodyi LspA:

  • SDS-PAGE gel-shift assay: This method monitors the cleavage of a model prolipoprotein substrate (such as ppICP) by LspA through visualization of the resulting molecular weight shift. Inhibition is quantified by measuring the reduction in the signal intensity of the product (DA-ICP). This assay has successfully identified specific LspA inhibitors such as compounds G2a and G2d .

  • Fluorescence-based assays: Development of FRET-based substrates containing LspA cleavage sites allows for high-throughput screening of inhibitor libraries in a 96-well or 384-well format.

  • Thermal shift assays: Differential scanning fluorimetry can detect inhibitor binding by measuring changes in the thermal stability of LspA upon compound binding.

  • Bacterial growth inhibition: Compounds that specifically target LspA can be tested for their ability to inhibit the growth of reference and multi-drug-resistant bacterial strains .

  • Computational screening: Virtual screening approaches using the conformational dynamics information from MD simulations can pre-select potential inhibitors before experimental testing, as demonstrated in the design of cyclic peptide inhibitors .

For comprehensive assessment, researchers should employ multiple orthogonal assays to confirm specificity and rule out false positives.

How does S. woodyi LspA compare to LspA in other bacterial species?

S. woodyi LspA shares fundamental structural and functional characteristics with LspA proteins from other bacterial species, but with notable differences that reflect evolutionary adaptation:

  • Sequence conservation: Key catalytic residues and functional domains are highly conserved across bacterial LspA proteins, including the aspartyl protease active site motif. Alignment of deduced amino acid sequences shows the presence of highly conserved residues and domains that are essential for SPase II activity .

  • Species-specific adaptations: While the core catalytic machinery is conserved, S. woodyi LspA may contain adaptations that reflect the marine environment and psychrophilic lifestyle of this bioluminescent bacterium.

  • Genomic context: Within the Shewanella genus, which shows significant genetic mobility, the lspA gene and other components of the lipoprotein processing pathway may exhibit different genomic organizations or regulatory elements compared to other bacterial species .

  • Functional complementation: Despite species differences, recombinant LspA from one bacterial species can often functionally complement LspA deficiency in another species. For example, recombinant lspA from Rickettsia typhi significantly restores the growth of temperature-sensitive E. coli Y815 at non-permissive temperatures, supporting its biological activity as SPase II in prolipoprotein processing .

  • Inhibitor sensitivity: While most LspA proteins are sensitive to globomycin, the degree of sensitivity may vary between species, reflecting subtle structural differences in the inhibitor binding site.

What evolutionary patterns are observed in LspA across the Shewanella genus?

The Shewanella genus exhibits interesting evolutionary patterns regarding LspA and other mobile genetic elements:

  • Genomic plasticity: Shewanella species are known for their capability to acquire a wide variety of mobile elements, including plasmids, prophages, group II introns, integrons, and integrative and conjugative elements, which may influence the evolution of genes like lspA .

  • Taxonomic complexity: Phylogenetic analyses of Shewanella spp. have revealed both polyphyletic and monophyletic groups, with some clusters showing marginally significant Average Nucleotide Identity (ANI) values (94% < ANI < 96%), suggesting ongoing speciation events that may affect the evolution of core proteins like LspA .

  • Niche adaptation: Different Shewanella species have adapted to diverse ecological niches, from marine environments to clinical settings. These adaptations may drive the evolution of LspA to process specific lipoproteins required for survival in these environments .

  • Horizontal gene transfer: The high genomic mobility observed in Shewanella suggests that horizontal gene transfer events may contribute to the evolution and spread of lspA variants with altered substrate specificity or inhibitor resistance .

  • Conservation of essential function: Despite genomic diversity, the essential nature of LspA likely constrains its evolution, with selective pressure maintaining key functional elements while allowing peripheral adaptations.

What are the implications of LspA research for understanding bacterial pathogenesis?

Research on S. woodyi LspA and related enzymes has significant implications for understanding bacterial pathogenesis:

  • Virulence factor processing: LspA processes lipoproteins that act as virulence factors in pathogenic bacteria. Understanding this processing is crucial for identifying new therapeutic targets .

  • Misidentification of pathogens: Comparative genomic studies of Shewanella have revealed that S. putrefaciens isolates may have been misidentified and overestimated as opportunistic pathogens, highlighting the importance of accurate species identification in pathogenesis research .

  • Expression patterns during infection: Transcriptional analysis of lipoprotein processing genes (lspA, lgt, lepB) during intracellular growth reveals differential expression patterns. The higher transcriptional level of these genes at preinfection time points indicates that "only live and metabolically active rickettsiae are capable of infection and inducing host cell phagocytosis" .

  • Role in different infection stages: LspA activity varies during different stages of bacterial growth and infection, with implications for understanding when and how pathogens establish infection .

  • Antibiotic development: The essentiality of LspA in Gram-negative bacteria and its importance for virulence in Gram-positive bacteria make it a promising target for developing new antibiotics against multidrug-resistant pathogens .

How can molecular dynamics simulations enhance understanding of LspA function?

Molecular dynamics (MD) simulations have proven invaluable for understanding LspA function beyond what static structural studies can reveal:

  • Conformational landscape mapping: MD simulations have revealed that LspA samples at least three distinct conformational states (closed, intermediate, and open), providing insight into the structural basis of substrate recognition and catalysis .

  • Nanosecond-scale dynamics: The periplasmic helix of LspA fluctuates on the nanosecond timescale, a dynamic behavior that would be missed by static structural techniques but is captured through MD simulations .

  • Inhibitor binding mechanisms: Simulations of inhibitor-bound states have shown that drugs like globomycin can bind in multiple modes, stabilizing different conformational states of the enzyme .

  • Rational drug design: The conformational dynamics information from MD simulations can guide the design of new inhibitors that target specific conformational states of LspA, as demonstrated in the computational design of cyclic peptide inhibitors .

  • Integration with experimental data: When combined with experimental techniques like EPR, MD simulations provide a more complete understanding of LspA function, as "each approach in isolation has its limitations, and only in combination were we able to visualize and map the conformational dynamics" .

Future applications could include enhanced sampling methods to explore rare conformational transitions and free energy calculations to quantify the energetics of substrate binding and catalysis.

What are the current challenges in structural studies of membrane-bound LspA?

Structural studies of membrane-bound enzymes like LspA face several significant challenges:

  • Membrane environment reproduction: Creating experimental conditions that accurately mimic the native membrane environment remains challenging. Different membrane mimetics (detergents, nanodiscs, liposomes) may induce artificial conformational states.

  • Conformational heterogeneity: LspA exists in multiple conformational states in dynamic equilibrium, making it difficult to capture the full structural landscape with techniques like X-ray crystallography that provide static snapshots .

  • Low expression levels: Membrane proteins often express at lower levels than soluble proteins, complicating production of sufficient material for structural studies.

  • Protein stability: Maintaining the stability and activity of purified LspA outside its native membrane environment is challenging, particularly during the time required for crystallization or NMR experiments.

  • Integration of techniques: As noted in the research, "each approach in isolation has its limitations, and only in combination were we able to visualize and map the conformational dynamics" . Developing integrated approaches that combine data from multiple techniques remains technically challenging.

Future advances may come from cryo-electron microscopy, which can handle conformational heterogeneity better than crystallography, and from improved membrane mimetics that better reproduce the native lipid environment.

What emerging technologies might advance S. woodyi LspA research?

Several emerging technologies show promise for advancing research on S. woodyi LspA:

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM resolution now allow visualization of membrane proteins in near-native environments and can capture multiple conformational states within a single sample.

  • Native mass spectrometry: This technique can analyze membrane proteins with bound lipids and ligands, providing insights into the stoichiometry and specificity of interactions.

  • Single-molecule techniques: Methods such as single-molecule FRET can track conformational changes in real-time at the single-molecule level, revealing rare or transient states.

  • Nanobody technology: Developing nanobodies that recognize and stabilize specific conformational states of LspA could facilitate crystallization and structure determination of otherwise elusive conformations.

  • AI-driven protein structure prediction: Tools like AlphaFold2 and RosettaFold are increasingly accurate at predicting membrane protein structures and could complement experimental approaches.

  • High-throughput screening platforms: Advanced microfluidic systems allow for rapid screening of conditions for protein expression, purification, and crystallization, accelerating structural studies.

  • Genome editing technologies: CRISPR-Cas9 and related technologies enable precise genetic manipulation of S. woodyi to study LspA function in its native context.

These technologies, when integrated with established approaches like MD simulations and EPR spectroscopy, promise to provide unprecedented insights into the structure, function, and inhibition of S. woodyi LspA.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.