Recombinant Shewanella woodyi NADH-quinone oxidoreductase subunit K (nuoK)

What is Shewanella woodyi and how does it relate to other Shewanella species?

Shewanella woodyi is a Gram-negative rod bacterium belonging to the genus Shewanella, which is widely distributed in aquatic environments, particularly marine ecosystems . Unlike some of its relatives such as Shewanella algae and Shewanella xiamenensis that have been associated with human infections, S. woodyi is primarily known for its role as a symbiont or epibiont in aquatic environments . S. woodyi is phylogenetically distinct from clinical-associated Shewanella lineages, which include species recovered from skin and soft-tissue infections, biliary tract infections, peritonitis, and ocular infections . Comparative genomic analysis of 144 Shewanella species has revealed that S. woodyi belongs to a clade that is separate from the main clinical-related groups that encompass opportunistic pathogens .

Methodologically, researchers distinguish S. woodyi from other Shewanella species through:

• Phylogenetic analysis using concatenated orthologous genes

• Average nucleotide identity (ANI) comparisons, with values ≥95% indicating same-species classification

• Analysis of specific phenotypic traits including bioluminescence, which is characteristic of S. woodyi

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its function in bacterial metabolism?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the NADH dehydrogenase I complex (NDH-1), which plays a crucial role in bacterial respiratory chains . The protein functions as part of the membrane-embedded domain of the complex with EC classification 1.6.99.5 . In Shewanella woodyi, nuoK is encoded by the nuoK gene (locus tag: Swoo_2869) and consists of 100 amino acids with a predominantly hydrophobic sequence: "MIDTTWVIILSFLLFAIGTFGLLSRRNLLFILLSLEMLNGIILLFIAASNLHGGNNDGQIMYLLVLTLAASEVAVGLALVVQIYKQQQNLDVDTLTKLRG" .

The primary functions of nuoK include:

• Contributing to proton translocation across the cell membrane

• Participating in maintaining the structural integrity of the NDH-1 complex

• Enabling electron transfer from NADH to quinones in the respiratory chain

For research purposes, understanding nuoK's role requires examining it within the context of the complete NDH-1 complex, as its function is tightly integrated with other subunits in the respiratory system.

What are the primary methods for expressing and purifying recombinant nuoK protein?

Expressing and purifying membrane proteins like nuoK presents significant challenges due to their hydrophobic nature. Based on established protocols for similar proteins, researchers typically employ the following methodological approaches:

• Expression systems:

  • E. coli BL21(DE3) with specialized vectors containing T7 promoters

  • Cell-free expression systems for toxic membrane proteins

  • Specialized E. coli strains (C41, C43) engineered for membrane protein expression

• Expression optimization:

  • Induction at lower temperatures (16-25°C) to enhance proper folding

  • Reduced IPTG concentrations (0.1-0.5 mM) to slow expression rate

  • Addition of glycerol (5-10%) to stabilize membrane proteins

• Purification strategy:

  • Membrane isolation through ultracentrifugation

  • Solubilization using mild detergents (DDM, LMNG)

  • Immobilized metal affinity chromatography (IMAC) using His-tags

  • Size exclusion chromatography for final polishing

• Quality assessment:

  • SDS-PAGE and Western blotting for purity and identity verification

  • Mass spectrometry for sequence confirmation

  • Circular dichroism to verify secondary structure integrity

When working with nuoK from Shewanella woodyi specifically, researchers should consider adding stabilizing agents in the buffer system, as indicated by storage recommendations that include 50% glycerol in Tris-based buffer .

How should recombinant nuoK protein be stored to maintain structural and functional integrity?

Proper storage of membrane proteins like nuoK is critical for maintaining their structural integrity and biological activity. Based on established protocols and manufacturer recommendations for Shewanella woodyi nuoK specifically:

• Short-term storage (up to one week):

  • Store working aliquots at 4°C in Tris-based buffer with 50% glycerol

  • Maintain anaerobic conditions when possible to prevent oxidation

  • Use air-tight containers to prevent evaporation and concentration changes

• Long-term storage:

  • Store at -20°C for standard long-term storage

  • For extended preservation, use -80°C storage

  • Divide into small single-use aliquots to avoid repeated freeze-thaw cycles

  • Add cryo-protectants such as glycerol (already included at 50%)

• Critical considerations:

  • Repeated freezing and thawing is not recommended as it can lead to protein denaturation and aggregation

  • Buffer optimization may be necessary based on specific experimental requirements

  • Monitor pH stability during storage, as pH shifts can occur at low temperatures

  • Include reducing agents (e.g., DTT, β-mercaptoethanol) for proteins with cysteine residues to prevent disulfide bond formation

Following these methodological approaches helps ensure that the structural and functional properties of nuoK remain intact throughout the storage period, enhancing experimental reproducibility.

What experimental techniques are available for characterizing nuoK function?

Characterizing the function of membrane proteins like nuoK requires specialized techniques that address both structural and functional aspects:

• Structural characterization:

  • Cryo-electron microscopy for visualization within the NDH-1 complex

  • X-ray crystallography (challenging for membrane proteins but possible with lipidic cubic phase methods)

  • Nuclear magnetic resonance (NMR) for dynamic studies of smaller fragments

  • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

• Functional characterization:

  • Proteoliposome reconstitution assays to measure proton pumping activity

  • NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors

  • Site-directed mutagenesis to identify critical residues for function

  • Membrane potential measurements using fluorescent probes

• Interaction studies:

  • Cross-linking coupled with mass spectrometry to identify interaction partners

  • Fluorescence resonance energy transfer (FRET) for dynamic protein interactions

  • Blue native PAGE to assess complex assembly and stability

  • Surface plasmon resonance to measure binding kinetics with other subunits

• In silico analysis:

  • Molecular dynamics simulations to predict conformational changes

  • Homology modeling based on related structures

  • Sequence conservation analysis across species

Each method provides complementary information, and researchers typically employ multiple approaches to develop a comprehensive understanding of nuoK function within the respiratory chain.

How does nuoK from Shewanella woodyi compare to homologous proteins in other Shewanella species?

The comparative analysis of nuoK across Shewanella species reveals important evolutionary patterns and functional adaptations. Investigation of this question requires a multi-faceted approach:

These comparative analyses provide insights into how nuoK has evolved within the Shewanella genus and how variations might contribute to species-specific adaptations to different ecological niches.

What are the methodological considerations for studying nuoK interactions within the NADH-quinone oxidoreductase complex?

Investigating nuoK interactions within the larger NADH-quinone oxidoreductase complex requires specialized approaches that address the challenges of membrane protein complexes:

• Complex isolation strategies:

  • Mild detergent solubilization (digitonin, LMNG) to maintain native interactions

  • Affinity chromatography with tags on different subunits to pull down intact complexes

  • Gradient ultracentrifugation to separate intact complexes from subcomplexes

  • Native electrophoresis techniques to analyze complex integrity

• Interaction mapping approaches:

  Method	Advantages	Limitations	Key Considerations
  Chemical cross-linking + MS	Captures transient interactions	Potential artifacts	Cross-linker selection critical
  Co-immunoprecipitation	Relatively simple	Requires specific antibodies	Buffer optimization essential
  FRET/BRET	Real-time in vivo monitoring	Requires fluorescent tags	Tag position affects signals
  Cryo-EM	Visualizes entire complex	Resolution challenges	Sample homogeneity crucial
  Genetic suppressor analysis	Functional relevance	Indirect evidence	Multiple controls needed

• Reconstitution systems:

  • Nanodiscs for stabilization of subcomplexes

  • Proteoliposomes to assess functional coupling between subunits

  • Cell-free expression systems for simultaneous multi-subunit synthesis

• Computational approaches:

  • Molecular docking simulations

  • Coevolution analysis to predict interacting residues

  • Network analysis of protein-protein interaction data

• Validation strategies:

  • Mutagenesis of predicted interaction sites

  • Subcomplex assembly analysis

  • Activity assays with reconstituted systems of varying composition

When designing experiments to study nuoK interactions, researchers should consider the highly hydrophobic nature of this subunit (as evident from its amino acid sequence) and its small size (100 amino acids), which make it particularly challenging to study in isolation .

How do environmental adaptations influence nuoK structure and function in Shewanella woodyi compared to terrestrial bacteria?

Shewanella woodyi, as a marine bacterium, has evolved adaptations to function optimally in its natural environment. These adaptations are reflected in nuoK structure and function:

• Marine-specific adaptations in nuoK:

  • Higher proportion of acidic residues on surface-exposed regions to maintain protein solubility in high salt conditions

  • Modified hydrophobic core packing to accommodate pressure variations

  • Altered proton-binding sites to function efficiently at different pH levels found in marine environments

• Comparative analysis framework:

  Environmental Factor	S. woodyi Adaptation	Terrestrial Bacteria Feature	Functional Significance
  Salinity	Increased acidic residues	Fewer charged residues	Ion balance maintenance
  Temperature	Cold-adapted flexibility	More rigid structure	Activity at lower temperatures
  Pressure	Conformational resilience	Pressure sensitivity	Deep-sea functionality
  Oxygen availability	Efficient oxygen binding	Variable oxygen affinity	Adaptation to fluctuating O₂ levels

• Methodological approaches to study environmental adaptations:

  • Heterologous expression under varying conditions mimicking natural environments

  • Activity assays at different temperatures, pressures, and salt concentrations

  • Circular dichroism spectroscopy to assess structural stability under various conditions

  • Comparative molecular dynamics simulations incorporating environmental parameters

• Genomic context analysis:
  The nuoK gene in S. woodyi (Swoo_2869) exists within the operon structure of the NADH dehydrogenase complex . Comparative genomic analysis across the Shewanella genus can reveal conservation patterns and regulatory differences that reflect environmental adaptations . Such analysis should consider the mobile genetic elements prevalent in Shewanella species, as these can contribute to adaptive capabilities .

Understanding these environmental adaptations provides insights into bacterial bioenergetics and may inform biotechnological applications requiring proteins that function under extreme or unusual conditions.

What experimental approaches can address the challenges of studying proton translocation mediated by nuoK?

Proton translocation is a fundamental function of the NADH-quinone oxidoreductase complex, with nuoK playing a critical role in this process. Studying this function presents significant methodological challenges:

• Proton flux measurement techniques:

  • pH-sensitive fluorescent probes (BCECF, pyranine) incorporated into proteoliposomes

  • Microelectrode-based pH measurements in reconstituted systems

  • Stopped-flow rapid kinetics coupled with pH indicators

  • Patch-clamp electrophysiology for direct current measurements

• Site-directed mutagenesis strategy:

  Target Residue Type	Experimental Approach	Expected Outcome	Controls Required
  Conserved charged residues	Charge neutralization	Reduced proton translocation	Structural verification
  Conserved polar residues	H-bond disruption	Altered proton pathway	Activity with natural substrate
  Transmembrane residues	Hydrophobicity alterations	Changed proton selectivity	Membrane insertion confirmation
  Interface residues	Bulky side chain introduction	Disrupted subunit interactions	Complex assembly verification

• Reconstitution systems optimization:

  • Lipid composition adjustment to match S. woodyi native membrane

  • Protein:lipid ratio optimization for functional reconstitution

  • Co-reconstitution with minimal functional units of the complex

• Advanced spectroscopic approaches:

  • Time-resolved FTIR spectroscopy to capture protonation/deprotonation events

  • Electron paramagnetic resonance (EPR) to study coupled electron transfer

  • Solid-state NMR to identify key residues involved in proton pathways

• Computational methods:

  • Quantum mechanics/molecular mechanics simulations of proton transfer

  • pKa calculations under different conformational states

  • Proton pathway prediction algorithms

When designing these experiments, researchers should consider the highly hydrophobic nature of nuoK as indicated by its amino acid sequence (MIDTTWVIILSFLLFAIGTFGLLSRRNLLFILLSLEMLNGIILLFIAASNLHGGNNDGQIMYLLVLTLAASEVAVGLALVVQIYKQQQNLDVDTLTKLRG), which suggests multiple transmembrane segments involved in forming proton translocation pathways .

How can phylogenomic approaches enhance our understanding of nuoK evolution in the context of Shewanella ecological diversification?

Phylogenomic analysis offers powerful insights into how nuoK has evolved alongside the ecological diversification of Shewanella species:

• Comprehensive evolutionary framework:

  • Whole-genome phylogenetic analysis of 144 Shewanella genomes has established the evolutionary relationships between species

  • Average nucleotide identity (ANI) analysis with thresholds of ≥95% for species delineation provides a solid taxonomic foundation

  • Within this framework, nuoK evolution can be mapped to understand selective pressures in different lineages

• Correlation with ecological niches:

  Shewanella Lineage	Typical Habitat	nuoK Characteristics	Adaptive Significance
  S. woodyi clade	Marine, bioluminescent	Conserved proton channels	Optimized for symbiotic lifestyle
  Clinical-associated lineages	Human/animal hosts	Modified interaction domains	Host adaptation
  Metal-reducing species	Sediments, contaminated sites	Electron transfer adaptations	Respiration flexibility
  Cold-adapted species	Polar/deep sea environments	Flexibility-enhancing substitutions	Low-temperature function

• Methodological approach to phylogenomic analysis:

  • Ortholog identification across Shewanella genomes using reciprocal BLAST

  • Multiple sequence alignment of nuoK sequences using Clustal Omega

  • Maximum likelihood phylogenetic analysis with IQ-Tree using appropriate substitution models

  • Ancestral sequence reconstruction to identify key evolutionary transitions

  • Selection analysis (dN/dS ratios) to identify sites under positive selection

• Integration with genomic context:

  • Analysis of operon structure conservation across lineages

  • Identification of co-evolving genes within respiratory complexes

  • Assessment of horizontal gene transfer events affecting nuoK or related genes

  • Correlation with mobile genetic elements prevalent in Shewanella species

This phylogenomic approach reveals how nuoK evolution reflects the adaptation of Shewanella species to diverse environmental niches, from deep sea to clinical settings, providing insights into bacterial respiratory chain evolution and adaptation mechanisms.