Recombinant Shigella boydii serotype 18 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiA; SbBS512_E4557; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function

This recombinant Shigella boydii serotype 18 4-hydroxybenzoate octaprenyltransferase (UbiA) catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, yielding the membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.

Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) in Shigella boydii?

4-hydroxybenzoate octaprenyltransferase (ubiA) is an essential enzyme involved in ubiquinone biosynthesis pathways in Shigella boydii. The enzyme catalyzes the transfer of an octaprenyl group to 4-hydroxybenzoate, which is a critical step in the ubiquinone (coenzyme Q) biosynthesis pathway. This protein belongs to the enzyme classification EC= 2.5.1.- and is alternatively referred to as 4-HB polyprenyltransferase in scientific literature . The protein plays a crucial role in the bacterial respiratory chain and energy metabolism. In S. boydii serotype 18 (strain CDC 3083-94 / BS512), this enzyme is an important metabolic component that may contribute to the organism's survival under varying environmental conditions.

What are the structural characteristics of S. boydii serotype 18 ubiA protein?

The recombinant S. boydii serotype 18 ubiA protein is available as a partial protein with high purity (>85% as determined by SDS-PAGE) . While the complete amino acid sequence for serotype 18 isn't provided in the available sources, we can examine the related S. boydii serotype 4 (strain Sb227) ubiA, which consists of 290 amino acids with multiple transmembrane domains characteristic of membrane-bound prenyltransferases . The protein contains hydrophobic regions consistent with its membrane localization and function in ubiquinone biosynthesis. Researchers should note that the specific tag characteristics will be determined during the manufacturing process, which may affect purification strategies and potentially protein folding or activity in certain experimental contexts .

How does ubiA function compare across different Shigella serotypes?

While limited comparative data is available specifically on ubiA across Shigella serotypes, it's important to note that S. boydii has at least 20 different serotypes with varying prevalence rates and pathogenicity profiles . The functional conservation of metabolic enzymes like ubiA generally shows high sequence similarity across serotypes, but subtle variations may exist that could affect enzyme kinetics or substrate specificity. When conducting comparative studies, researchers should be aware that immunity to Shigella is serotype-specific , suggesting potential structural variations in surface-exposed proteins that could extend to membrane-associated proteins like ubiA. Any functional comparisons should include appropriate controls from multiple serotypes to establish meaningful differences.

What expression systems are optimal for producing functional recombinant S. boydii ubiA?

Recombinant S. boydii serotype 18 ubiA is commercially produced using yeast expression systems , which generally provide appropriate post-translational modifications for bacterial membrane proteins. For laboratory research purposes, several expression systems can be considered:

  • Yeast expression systems: Offer eukaryotic processing with relatively high yields for membrane proteins.

  • E. coli expression systems: May be suitable with appropriate membrane-targeting sequences and solubilization methods.

  • Cell-free expression systems: Useful for avoiding toxicity issues sometimes encountered with membrane protein expression.

When designing an expression strategy, researchers should consider codon optimization for the chosen host, inclusion of appropriate affinity tags that don't interfere with the catalytic domain, and temperature optimization to balance between protein yield and proper folding. The expression of membrane proteins like ubiA often requires specialized approaches to enhance membrane insertion and prevent aggregation.

What are the recommended storage and handling procedures for recombinant ubiA?

The shelf life of recombinant ubiA depends on multiple factors including storage buffer, temperature, and protein stability. For optimal results, the following guidelines are recommended:

  • Lyophilized form can be stored at -20°C/-80°C for up to 12 months

  • Liquid preparations have a typical shelf life of 6 months at -20°C/-80°C

  • Working aliquots should be stored at 4°C for no more than one week

  • Repeated freeze-thaw cycles should be strictly avoided

For reconstitution, briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 50% is recommended for long-term storage at -20°C/-80°C . This prevents protein denaturation during freeze-thaw cycles and maintains enzyme activity.

What purification strategies yield the highest activity for recombinant ubiA?

While specific purification protocols for S. boydii ubiA aren't detailed in the available sources, membrane proteins like ubiA typically require specialized approaches. Based on general principles for similar proteins, a multi-step purification strategy should include:

  • Initial extraction: Using appropriate detergents (e.g., DDM, LDAO) that maintain the native conformation of membrane proteins

  • Affinity chromatography: Utilizing the specific tag incorporated during recombinant expression (His-tag, GST, etc.)

  • Size exclusion chromatography: To separate protein aggregates and achieve higher homogeneity

  • Activity-based verification: Enzymatic assays to confirm that the purified protein maintains catalytic activity

The final purity should be verified by SDS-PAGE (target >85%) , and activity assays should be performed to ensure functionality before experimental use.

How can recombinant ubiA be used to study Shigella pathogenesis mechanisms?

Recombinant ubiA can serve as a valuable tool for investigating metabolic adaptations during Shigella infection. Recent research indicates that Shigella species, including S. boydii, can proliferate in plants in addition to their human hosts . This cross-kingdom pathogenicity suggests metabolic versatility that may involve ubiquinone biosynthesis pathways. Researchers can:

  • Conduct comparative studies of ubiA activity under different growth conditions mimicking human versus plant environments

  • Develop ubiA inhibitors to assess the importance of ubiquinone biosynthesis during infection of different hosts

  • Create ubiA knockout or knockdown strains to evaluate fitness costs in various infection models

  • Examine potential interactions between ubiA and virulence factors, particularly those involved in the type III secretion system (T3SS), which is crucial for Shigella pathogenesis

These approaches can help establish connections between basic metabolism and virulence mechanisms in this important human pathogen.

What are the methodological approaches for studying structure-function relationships in ubiA?

To investigate structure-function relationships in ubiA, researchers should consider:

  • Site-directed mutagenesis: Target conserved residues in the catalytic domain, substrate binding pocket, or membrane anchoring regions to assess their role in enzyme function

  • Domain swapping experiments: Exchange domains between ubiA from different Shigella serotypes or even different bacterial species to identify determinants of substrate specificity

  • Protein crystallography or cryo-EM: While challenging for membrane proteins, these techniques can provide crucial structural information when combined with computational modeling

  • Activity assays: Develop high-throughput enzymatic assays to quantify the effects of mutations on catalytic parameters (kcat, Km)

  • In silico modeling: Use homology modeling and molecular dynamics simulations to predict structural features and guide experimental design

The amino acid sequence from S. boydii serotype 4 provides a starting point for identifying conserved regions likely to be present in serotype 18 . Functional assays should be designed to detect both changes in catalytic efficiency and substrate specificity.

How does environmental adaptation affect ubiA function in different S. boydii serotypes?

S. boydii has shown remarkable adaptability to different hosts, including plants . This cross-kingdom pathogenicity raises interesting questions about metabolic adaptations:

  • Does ubiA enzymatic activity differ when the bacteria are grown in plant versus animal tissue cultures?

  • Are there structural or regulatory adaptations in ubiA that contribute to survival in different environments?

  • How does temperature, pH, or nutrient availability affect ubiA expression and activity?

Research approaches could include comparative expression analysis of ubiA under different growth conditions, measurement of enzyme kinetics using recombinant protein in buffers mimicking different host environments, and in vivo studies using reporter constructs to monitor ubiA expression during host colonization.

What controls are essential when working with recombinant ubiA in enzymatic assays?

When designing enzymatic assays with recombinant ubiA, researchers should implement the following controls:

  • Negative enzyme control: Heat-inactivated enzyme or buffer-only condition to establish baseline measurements

  • Substrate specificity controls: Testing related substrates to confirm enzyme specificity

  • Inhibitor controls: Known inhibitors of prenyltransferases to validate assay sensitivity

  • Native enzyme comparison: When possible, compare with native enzyme extracted from S. boydii to account for potential differences in activity

  • Time course measurements: Ensure reactions are measured in the linear range of enzyme activity

  • Buffer composition controls: Test activity in different buffer conditions to optimize reaction conditions

These controls help distinguish specific enzymatic activity from artifacts and ensure the reliability and reproducibility of experimental results. Additionally, researchers should include appropriate controls for the specific detection method employed (fluorescence, radioactivity, etc.).

How should researchers interpret conflicting data between recombinant and native ubiA?

Discrepancies between recombinant and native ubiA activity may arise from several factors:

  • Post-translational modifications: Native ubiA may undergo modifications absent in recombinant versions

  • Protein folding differences: Expression systems may not reproduce the exact folding environment of Shigella

  • Membrane environment effects: Native ubiA functions in bacterial membranes with specific lipid compositions

  • Protein-protein interactions: Native ubiA may interact with other proteins in complexes that enhance function

  • Protein stability differences: Storage conditions may affect recombinant protein differently than native forms

When confronted with such discrepancies, researchers should:

  • Characterize both forms using multiple complementary techniques (activity assays, thermal stability, circular dichroism)

  • Consider reconstitution of recombinant ubiA into liposomes mimicking bacterial membrane composition

  • Evaluate potential interacting partners from Shigella that might be co-purified with native enzyme

  • Adjust experimental conditions to minimize the impact of these differences when making comparative assessments

What parameters should be optimized for functional assays with recombinant ubiA?

For optimal functional assays with recombinant ubiA, researchers should systematically optimize:

  • Buffer composition: pH, ionic strength, presence of divalent cations (Mg²⁺, Mn²⁺)

  • Detergent concentration: Finding the minimum concentration that maintains protein solubility without inhibiting activity

  • Substrate concentrations: Determining Km values for both 4-hydroxybenzoate and the prenyl donor

  • Temperature and time: Finding optimal reaction temperature and ensuring measurements within the linear range

  • Enzyme concentration: Using enzyme dilutions to ensure proportional activity and avoid substrate depletion

  • Detection method sensitivity: Ensuring signal-to-noise ratio is adequate for reliable measurements

A design of experiments (DOE) approach can efficiently identify optimal conditions and potential interaction effects between parameters. Validation across different protein preparations is essential to ensure reproducibility of the optimized protocol.

What statistical approaches are most appropriate for analyzing ubiA enzymatic data?

When analyzing enzymatic data from ubiA experiments, researchers should consider:

  • Enzyme kinetics modeling: Apply Michaelis-Menten or other appropriate models to determine kinetic parameters (Km, Vmax, kcat)

  • Replicate analysis: Perform experiments with at least three biological replicates and appropriate technical replicates

  • Outlier detection: Use standard statistical tests (Grubbs' test, Dixon's Q test) to identify and address outliers

  • Comparative statistics: Use ANOVA with post-hoc tests for comparing multiple conditions or paired t-tests for direct comparisons

  • Non-parametric alternatives: Consider Kruskal-Wallis or Mann-Whitney tests if data doesn't meet normality assumptions

For inhibition studies, IC50 determination should include proper curve fitting with confidence intervals. Researchers should report not only p-values but also effect sizes and confidence intervals to provide a complete picture of the experimental results.

How can researchers distinguish between specific and non-specific effects in ubiA inhibition studies?

To differentiate between specific and non-specific inhibition of ubiA activity, researchers should:

  • Test against control enzymes: Examine inhibitor effects on unrelated enzymes to identify general protein-denaturing effects

  • Perform dose-response curves: Specific inhibitors typically show sigmoidal dose-response relationships

  • Conduct mechanism of inhibition studies: Determine if inhibition is competitive, non-competitive, or uncompetitive

  • Evaluate reversibility: Specific inhibitors often show reversible binding upon dilution or dialysis

  • Assess structure-activity relationships: Test structural analogs of inhibitors to confirm binding specificity

  • Consider detergent effects: Some compounds may interfere with the detergent micelles rather than the enzyme itself

These approaches collectively help establish inhibitor specificity and mechanism of action, essential information for developing targeted modulators of ubiA activity for research or potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.