Recombinant Shigella boydii serotype 18 Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and may be used as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development of the specified tag.
Synonyms
aas; SbBS512_E3026; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
aas
Target Protein Sequence
MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVAMPDASRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWIDEAEQHDE
Uniprot No.

Target Background

Function

This bifunctional protein plays a critical role in lysophospholipid acylation. Specifically, it catalyzes the transfer of fatty acids to the sn-1 position of lysophospholipids via an enzyme-bound acyl-acyl carrier protein (ACP) intermediate. This process requires ATP and magnesium ions. Its physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a product of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Shigella boydii serotype 18 Bifunctional protein aas (aas)?

The Bifunctional protein aas from Shigella boydii serotype 18 (strain CDC 3083-94/BS512) is a full-length protein consisting of 719 amino acids. The protein contains multiple functional domains including a 2-acylglycerophosphoethanolamine acyltransferase domain (EC 2.3.1.40). Its amino acid sequence begins with mLFSFFRNLCRVLYR and contains regions with various functional properties related to membrane phospholipid modification . The protein's bifunctional nature is reflected in its ability to perform multiple enzymatic activities, which are critical for the bacterial cell membrane structure and function.

How is Shigella boydii serotype 18 classified within the Shigella genus?

Shigella boydii serotype 18 is one of multiple serotypes of the S. boydii species, classified primarily based on its unique O antigen structure. Shigella strains are Gram-negative bacterial pathogens that are typically identified by their O antigens, which are essential components of the lipopolysaccharide present in the outer membrane . The O antigen of S. boydii type 18 has a distinctive linear pentasaccharide repeating unit consisting of three L-rhamnose residues, one D-galacturonic acid (D-GalA) residue, and one N-acetylgalactosamine (D-GalNAc) residue, with a specific structure: →3)-β-L-Rhap-(1→4)-α-L-Rhap-(1→2)-α-L-Rhap-(1→2)-α-D-GalpA-(1→3)-α-D-GalpNAc-(1→ .

What are the primary functions of Bifunctional protein aas in Shigella boydii serotype 18?

The Bifunctional protein aas in S. boydii serotype 18 serves multiple critical cellular functions. As indicated by its name, it performs at least two enzymatic activities:

  • It acts as a 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40), also known as 2-acyl-GPE acyltransferase

  • It functions as an acyl-[acyl-carrier-protein]--phospholipid acyltransferase

These enzymatic activities are essential for phospholipid metabolism and membrane biogenesis in the bacterium. The protein plays a crucial role in maintaining the integrity and proper function of the bacterial cell membrane, which is particularly important for bacterial survival, adaptation to environmental conditions, and potentially for pathogenicity.

What are the optimal conditions for expressing recombinant Shigella boydii serotype 18 Bifunctional protein aas?

For optimal expression of recombinant S. boydii serotype 18 Bifunctional protein aas, researchers should consider the following methodological approach:

  • Expression System Selection: E. coli-based expression systems are commonly used for bacterial proteins. BL21(DE3) or Rosetta strains may be particularly suitable for this protein due to its size and complexity.

  • Vector Design: Incorporate appropriate promoters (T7 or tac) and fusion tags (His, GST, or MBP) to facilitate expression and subsequent purification. The tag type should be determined during the production process based on protein solubility and activity requirements .

  • Growth Conditions:

    • Temperature: Lower temperatures (16-25°C) post-induction often improve proper folding

    • Media: Rich media (LB, TB) supplemented with appropriate antibiotics

    • Induction: IPTG concentration between 0.1-1.0 mM based on optimization tests

  • Harvest and Storage: Cell pellets should be collected by centrifugation and can be stored at -80°C until purification.

The successful expression of this membrane-associated protein may require optimization of these parameters based on specific experimental needs and downstream applications.

How can researchers effectively purify Recombinant Shigella boydii serotype 18 Bifunctional protein aas for structural studies?

Purification of Recombinant S. boydii serotype 18 Bifunctional protein aas for structural studies requires a multi-step approach:

  • Cell Lysis: Use gentle lysis methods such as sonication or French press in a buffer containing detergents (e.g., 0.5-1% Triton X-100 or n-dodecyl β-D-maltoside) to solubilize this membrane-associated protein.

  • Initial Purification: Employ affinity chromatography based on the fusion tag used:

    • His-tag: Ni-NTA resin with imidazole gradient elution

    • GST-tag: Glutathione Sepharose with reduced glutathione elution

  • Secondary Purification: Use ion exchange chromatography (IEX) and/or size exclusion chromatography (SEC) to achieve high purity.

  • Buffer Optimization: The final purified protein should be maintained in Tris-based buffer with 50% glycerol optimized specifically for this protein . Consider including stabilizing agents like glycerol and reducing agents (DTT or β-mercaptoethanol).

  • Quality Control: Assess purity by SDS-PAGE and Western blotting; protein activity can be evaluated through enzymatic assays specific to the 2-acylglycerophosphoethanolamine acyltransferase function.

  • Storage: Store at -20°C for routine use, or at -80°C for extended storage. Prepare working aliquots to be stored at 4°C for up to one week to avoid repeated freeze-thaw cycles .

For structural studies (X-ray crystallography, Cryo-EM, or NMR), additional buffer optimization may be necessary to promote protein stability and homogeneity.

What are the recommended functional assays for assessing Bifunctional protein aas activity?

To comprehensively assess the functionality of S. boydii serotype 18 Bifunctional protein aas, researchers should implement the following assays:

  • Acyltransferase Activity Assay:

    • Substrate utilization: Measure the transfer of acyl groups from acyl-ACP to lysophospholipids

    • Detection methods: Radiolabeled substrates ([14C]acyl-ACP) or fluorescent analogs

    • Quantification: TLC separation followed by autoradiography or fluorescence scanning

  • Phospholipid Analysis:

    • Extraction of cellular phospholipids using Bligh-Dyer method

    • Mass spectrometry analysis to determine changes in phospholipid profiles

    • Comparative analysis between wild-type and mutant strains or recombinant expression systems

  • Membrane Integrity Assays:

    • Fluorescent dye exclusion (propidium iodide)

    • Membrane permeability studies

    • Fatty acid composition analysis of bacterial membrane phospholipids

  • Enzyme Kinetics:

    • Determination of Km and Vmax values for various substrates

    • Inhibition studies to evaluate specificity

    • pH and temperature optima determination

  • Mutational Analysis:

    • Site-directed mutagenesis of conserved residues

    • Comparative activity analysis of wild-type vs. mutant proteins

These methodological approaches provide a comprehensive evaluation of both enzymatic activities of the bifunctional protein, allowing researchers to dissect individual functions and their contributions to bacterial physiology.

What are the key genetic features of the S. boydii serotype 18 aas gene locus?

The aas gene in Shigella boydii serotype 18 (strain CDC 3083-94/BS512) is designated by the ordered locus name SbBS512_E3026 . While detailed information specifically about the aas gene locus in serotype 18 is limited in the provided search results, we can infer from related research on Shigella genomics:

The gene encodes the full-length Bifunctional protein aas, which spans 719 amino acids. Like other bacterial genes, the aas gene likely contains:

  • A promoter region with typical -35 and -10 elements for RNA polymerase binding

  • A ribosome binding site (Shine-Dalgarno sequence) upstream of the start codon

  • The coding sequence without introns (as typical for bacterial genes)

  • A termination sequence after the stop codon

Understanding the genetic context surrounding the aas gene would require analysis of the complete genome sequence of S. boydii serotype 18, focusing on adjacent genes that might form an operon or have related functions in phospholipid metabolism. This information would be valuable for researchers investigating transcriptional regulation and evolutionary relationships of this gene.

How does the genetic organization of aas gene in S. boydii serotype 18 compare with other Shigella serotypes?

Comparative analysis of the aas gene across Shigella serotypes reveals important evolutionary insights:

While the search results don't provide direct comparative data for the aas gene specifically, we can extrapolate from O antigen genetic organization patterns. The O antigen gene clusters in Shigella strains, including S. boydii serotype 18, are located between conserved galF and gnd genes . This genomic arrangement is characteristic of many Enterobacteriaceae.

For S. boydii serotype 18, the O antigen gene cluster contains nine open reading frames (ORFs) involved in rhamnose synthesis, sugar transfer, and O unit processing . In comparison, S. boydii type 13 has a different arrangement of genes in this region, with many genes being specific to that serotype .

Research methodologies for comparative genetic analysis should include:

  • Whole genome sequencing using next-generation sequencing platforms

  • Comparative genomics using bioinformatics tools like BLAST, MAUVE, or progressive alignment methods

  • Phylogenetic analysis to establish evolutionary relationships

  • PCR-based approaches targeting conserved and variable regions of the aas gene

These approaches would help determine the degree of conservation of the aas gene across Shigella species and provide insights into the evolutionary forces shaping this gene's structure and function.

What strategies can be employed for targeted mutagenesis of the aas gene in S. boydii serotype 18?

For effective targeted mutagenesis of the aas gene in S. boydii serotype 18, researchers should consider the following methodological approaches:

  • RED Recombination System:

    • Based on the phage lambda RED recombination system as described for other Shigella genes

    • Design primers with 36 bp homology arms flanking the aas gene

    • Amplify a selection marker (e.g., chloramphenicol acetyltransferase gene) with these primers

    • Transform the PCR product into S. boydii carrying the pKD20 plasmid with inducible RED genes

    • Select transformants with appropriate antibiotics

  • CRISPR-Cas9 System:

    • Design sgRNAs targeting specific regions of the aas gene

    • Introduce the CRISPR-Cas9 system via plasmid transformation

    • Provide repair templates for precise modifications

    • Screen for successful mutants by sequencing

  • Site-Directed Mutagenesis:

    • For recombinant protein studies, introduce specific mutations in expression vectors

    • Use PCR-based methods like QuikChange or overlap extension PCR

    • Verify mutations by sequencing before expression studies

  • Transposon Mutagenesis:

    • Use transposon systems like Tn5 or mariner for random insertions

    • Screen for insertions in the aas gene

    • Characterize the resulting phenotypes

  • Allelic Exchange:

    • Create constructs with mutated versions of the aas gene flanked by homologous regions

    • Introduce via conjugation or electroporation

    • Select for double crossover events that replace the native gene

These approaches provide flexibility for different research objectives, from complete gene knockouts to subtle amino acid substitutions for structure-function studies of the Bifunctional protein aas.

How does Bifunctional protein aas contribute to the pathogenicity of Shigella boydii serotype 18?

The contribution of Bifunctional protein aas to S. boydii serotype 18 pathogenicity likely involves multiple mechanisms:

  • Membrane Integrity and Adaptation: As a bifunctional enzyme involved in phospholipid metabolism, aas plays a crucial role in maintaining membrane integrity under various environmental conditions encountered during infection. Proper membrane function is essential for virulence factor secretion and resistance to host defense mechanisms.

  • Link to O Antigen Function: Although aas is not directly part of the O antigen gene cluster, its membrane-related functions may interact with O antigen presentation. O antigens are critical virulence determinants in Shigella and play an important role in pathogenicity . The O antigen of S. boydii serotype 18 has a specific pentasaccharide structure that contributes to bacterial surface properties and interactions with host cells .

  • Potential Immune Evasion: Modifications to bacterial membrane phospholipids can affect recognition by host immune systems. The acyltransferase activity of aas could potentially modify membrane composition in ways that help evade host defenses.

  • Intracellular Survival: Since Shigella species have an intracellular mode of colonization , the membrane remodeling functions of aas may be particularly important for adaptation to the intracellular environment and survival within host cells.

Future research should focus on creating aas knockout mutants and comparing their virulence to wild-type S. boydii serotype 18 in cellular and animal infection models to elucidate its precise role in pathogenicity.

What experimental models are most appropriate for studying S. boydii serotype 18 interactions with host cells?

For studying S. boydii serotype 18 interactions with host cells, researchers should consider the following experimental models:

  • In Vitro Cellular Models:

    • Intestinal Epithelial Cell Lines: Caco-2, HT-29, or T84 cells, which recapitulate aspects of human intestinal epithelium

    • Macrophage Cell Lines: THP-1 (human) or RAW264.7 (murine) for studying bacterial survival in phagocytes

    • 3D Organoid Models: Human intestinal organoids that better represent the complex intestinal epithelium

    • Co-culture Systems: Combining epithelial cells with immune cells to study complex interactions

  • Ex Vivo Models:

    • Intestinal Tissue Explants: Human or animal intestinal tissues maintained in culture

    • Perfused Intestinal Segments: For studying interactions in a more physiological context

  • In Vivo Models:

    • Mouse Models: Including conventional and humanized mice

    • Guinea Pig Models: Often used for Shigella infections due to similar pathology to humans

    • Rabbit Ileal Loop Model: For studying localized intestinal responses

  • Methodological Approaches:

    • Invasion Assays: Gentamicin protection assays to quantify bacterial invasion

    • Intracellular Survival Assays: Time-course studies of bacterial persistence

    • Microscopy Techniques: Confocal and electron microscopy to visualize host-pathogen interactions

    • Transcriptomics/Proteomics: To study host and bacterial responses during infection

    • CRISPR-modified Host Cells: To investigate specific host factors

These models allow researchers to investigate different aspects of S. boydii serotype 18 pathogenesis, from initial attachment and invasion to intracellular survival and host immune responses, with varying degrees of complexity and physiological relevance.

How can researchers investigate the immunological responses to Bifunctional protein aas in S. boydii serotype 18 infections?

To comprehensively investigate immunological responses to Bifunctional protein aas in S. boydii serotype 18 infections, researchers should employ the following methodological approaches:

  • Recombinant Protein Immunization Studies:

    • Purify recombinant Bifunctional protein aas

    • Immunize experimental animals (mice, rabbits)

    • Analyze antibody responses (titer, isotype, specificity)

    • Evaluate protective efficacy against challenge

  • T Cell Response Analysis:

    • Identify potential T cell epitopes using prediction algorithms

    • Synthesize peptides corresponding to predicted epitopes

    • Perform in vitro stimulation assays with peripheral blood mononuclear cells (PBMCs)

    • Measure T cell proliferation, cytokine production, and phenotyping

  • Innate Immune Response Studies:

    • Stimulate macrophages, dendritic cells with purified protein

    • Measure cytokine/chemokine production (IL-1β, TNF-α, IL-6, IL-8)

    • Analyze activation of pattern recognition receptors (TLRs, NLRs)

    • Evaluate phagocytosis and bacterial killing

  • Comparative Immunology:

    • Compare immune responses to wild-type vs. aas-deficient S. boydii

    • Analyze differences in inflammatory signatures

    • Evaluate tissue pathology in infection models

  • Translational Human Studies:

    • Analyze serum samples from patients with confirmed S. boydii serotype 18 infections

    • Measure antibody responses to recombinant aas protein

    • Characterize memory T cell responses in convalescent individuals

  • Advanced Technologies:

    • Single-cell RNA sequencing to identify responding immune cell populations

    • CyTOF or spectral flow cytometry for detailed immune phenotyping

    • Spatial transcriptomics to map immune responses in infected tissues

These approaches will provide insights into whether Bifunctional protein aas is immunogenic during natural infection, its potential as a vaccine candidate, and its possible role in modulating host immune responses during S. boydii serotype 18 pathogenesis.

How does S. boydii serotype 18 Bifunctional protein aas compare structurally and functionally with homologous proteins in other enteric bacteria?

Comparative analysis of S. boydii serotype 18 Bifunctional protein aas with homologous proteins in other enteric bacteria reveals important structural and functional relationships:

While detailed comparative data specifically for the Bifunctional protein aas is not provided in the search results, we can infer from bacterial protein evolution patterns that this protein likely shares significant homology with corresponding proteins in related Enterobacteriaceae. The core functional domains, particularly the 2-acylglycerophosphoethanolamine acyltransferase domain (EC 2.3.1.40), are likely conserved across species due to their fundamental role in phospholipid metabolism.

A comprehensive comparative analysis methodology would involve:

  • Sequence Alignment:

    • Multiple sequence alignment of aas proteins from diverse enteric bacteria

    • Identification of conserved domains and motifs

    • Calculation of sequence identity and similarity percentages

  • Structural Comparison:

    • Homology modeling based on crystal structures if available

    • Analysis of protein topology and domain organization

    • Identification of conserved catalytic residues

  • Phylogenetic Analysis:

    • Construction of phylogenetic trees to understand evolutionary relationships

    • Evaluation of selection pressures on different protein regions

    • Identification of species-specific adaptations

  • Functional Conservation Testing:

    • Complementation studies with aas genes from different species

    • Enzymatic activity comparisons using standardized assays

    • Substrate specificity determination across homologs

This comparative approach would help identify both the core conserved functions of Bifunctional protein aas essential across enteric bacteria and any specialized adaptations specific to S. boydii serotype 18 that might relate to its pathogenic lifestyle.

What are the evolutionary implications of S. boydii serotype 18 O antigen structure and its relationship to the function of membrane proteins like aas?

The evolutionary implications of S. boydii serotype 18 O antigen structure and its relationship to membrane proteins like aas present a fascinating area for scientific investigation:

  • O Antigen Structural Evolution:
    The O antigen of S. boydii serotype 18 has a distinct linear pentasaccharide repeating unit with three L-rhamnose residues, one D-galacturonic acid, and one N-acetylgalactosamine . This specific structure represents an evolutionary adaptation that likely confers specific advantages in host interaction or environmental survival.

  • Coevolution of Membrane Components:
    Although aas is not directly involved in O antigen synthesis, the functions of membrane proteins and O antigens are interdependent. The Bifunctional protein aas, through its role in phospholipid metabolism, helps maintain membrane integrity and composition, which indirectly affects O antigen presentation and function.

  • Selective Pressures:
    Evidence suggests rapid expansion of O antigen forms in Shigella strains, potentially reflecting adaptation to intracellular colonization . This evolutionary trajectory may have created selection pressures on membrane proteins like aas to co-adapt for optimal function within the changing membrane environment.

  • Horizontal Gene Transfer:
    The O antigen gene clusters of Shigella strains show evidence of recent formation and potential horizontal gene transfer . These genetic dynamics may influence the broader genomic context in which the aas gene functions.

  • Pathogenic Specialization:
    The O antigen is an important factor in pathogenicity, and new O antigen forms may improve fitness in the intracellular lifestyle of Shigella . Membrane proteins like aas may have co-evolved with these specialized structures to support pathogenic mechanisms.

Research methodologies to explore these evolutionary relationships should include comparative genomics, molecular clock analyses, selection pressure calculations (dN/dS ratios), and functional studies comparing membrane dynamics across Shigella serotypes with different O antigen structures.

What bioinformatic approaches are most effective for predicting functional domains and regulatory elements of the Bifunctional protein aas?

For effective prediction of functional domains and regulatory elements of Bifunctional protein aas, researchers should employ a multi-layered bioinformatic approach:

  • Protein Domain Analysis:

    • InterPro/Pfam Scanning: Identify conserved domains such as the 2-acylglycerophosphoethanolamine acyltransferase domain

    • SMART/ProSite: Detect functional motifs and signature sequences

    • Conserved Domain Database (CDD): Compare with NCBI's collection of annotated domains

    • HMMer: Build hidden Markov models from aligned homologous sequences for sensitive domain detection

  • Structural Prediction:

    • AlphaFold2/RoseTTAFold: Generate accurate 3D structural models

    • PSIPRED: Predict secondary structure elements

    • TMHMM/TOPCONS: Identify transmembrane regions critical for membrane-associated functions

    • 3DLigandSite: Predict ligand binding sites and catalytic residues

  • Functional Site Identification:

    • ConSurf: Identify evolutionarily conserved residues

    • ScanProsite: Detect enzyme active sites and substrate binding motifs

    • PrePs: Predict post-translational modification sites

    • FunFHMMer: Functional classification of domains

  • Regulatory Element Analysis:

    • MEME Suite: Discover regulatory motifs in DNA sequences

    • JASPAR/TRANSFAC: Identify transcription factor binding sites

    • RBPmap: Predict RNA-binding protein sites for post-transcriptional regulation

    • PromPredict/Neural Network Promoter Prediction: Identify potential promoter regions

  • Comparative Genomics Approaches:

    • Phylogenetic Footprinting: Identify conserved non-coding regions among related species

    • Synteny Analysis: Examine gene order conservation and operonic structures

    • dN/dS Analysis: Identify regions under positive or purifying selection

  • Integrated Approaches:

    • Meta-servers like PredictProtein or ANNOTATOR that combine multiple prediction methods

    • Network Analysis: Predict functional associations via STRING or similar tools

    • Machine Learning Models: Train on known bacterial bifunctional proteins to identify novel features

These computational methodologies provide a comprehensive framework for characterizing the functional elements of Bifunctional protein aas, generating testable hypotheses that can guide subsequent experimental validation.

How can Recombinant S. boydii serotype 18 Bifunctional protein aas be utilized in developing diagnostic tools?

Recombinant S. boydii serotype 18 Bifunctional protein aas offers significant potential for diagnostic tool development through several methodological approaches:

  • Serological Diagnostic Applications:

    • Use purified recombinant protein as an antigen in ELISA-based detection systems

    • Develop lateral flow immunoassays (LFIAs) for rapid point-of-care diagnostics

    • Create protein microarrays incorporating multiple Shigella antigens including aas for multiplex detection

    • Generate monoclonal antibodies against unique epitopes for sensitive detection

  • Molecular Diagnostic Approaches:

    • Design PCR primers targeting the aas gene sequence specific to S. boydii serotype 18

    • Develop LAMP (Loop-mediated isothermal amplification) assays for field-deployable detection

    • Create DNA microarrays incorporating probes for the aas gene along with other serotype-specific markers

    • Implement CRISPR-Cas-based detection systems targeting unique regions of the aas gene

  • Differential Diagnostic Strategies:

    • Combine aas detection with other serotype-specific markers like O antigen genes

    • Develop multiplexed systems to differentiate between various Shigella boydii serotypes

    • Create algorithms for interpreting patterns of reactivity across multiple markers

  • Validation and Implementation:

    • Compare sensitivity and specificity with gold standard methods

    • Validate using clinical isolates and environmental samples

    • Assess performance in resource-limited settings

    • Optimize for field use in endemic regions like Bangladesh

The specificity of bacterial proteins like aas can be leveraged to develop diagnostic tools that distinguish between closely related pathogens, potentially offering advantages over current methods that primarily rely on O antigen typing .

What are the current challenges in developing experimental systems to study Bifunctional protein aas enzymatic activities?

Researchers face several significant challenges when developing experimental systems to study the enzymatic activities of Bifunctional protein aas:

  • Protein Solubility and Stability Issues:

    • As a membrane-associated protein, aas is often challenging to express in soluble, active form

    • Maintaining stability during purification requires specialized buffers with 50% glycerol and appropriate detergents

    • Preventing aggregation while preserving native structure necessitates careful optimization

  • Dual Functionality Assessment:

    • Designing assays that can separately evaluate both enzymatic activities

    • Ensuring that conditions optimal for one function don't inhibit the other

    • Developing high-throughput methods to screen both activities simultaneously

  • Substrate Availability and Specificity:

    • Synthesizing or sourcing appropriate lipid substrates for enzymatic assays

    • Determining natural substrate preferences in the bacterial membrane context

    • Establishing structure-activity relationships for various substrates

  • Assay Development Complexities:

    • Creating sensitive detection methods for lipid modifications

    • Dealing with interfering compounds in complex reaction mixtures

    • Standardizing assays for comparative studies across different conditions

  • In Vitro vs. In Vivo Activity Correlation:

    • Bridging the gap between purified protein studies and physiological functions

    • Recreating membrane environments in vitro that reflect in vivo conditions

    • Developing cellular systems that allow monitoring of aas activity in living bacteria

  • Technical Approaches to Address Challenges:

    • Fusion protein strategies to enhance solubility

    • Nanodiscs or liposome incorporation to mimic membrane environments

    • Mass spectrometry-based assays for precise product identification

    • Genetic reporter systems for in vivo activity monitoring

Overcoming these challenges requires interdisciplinary approaches combining protein biochemistry, lipid chemistry, analytical techniques, and molecular biology methodologies.

How might understanding the structure-function relationship of Bifunctional protein aas contribute to antimicrobial drug development?

Understanding the structure-function relationship of Bifunctional protein aas offers promising avenues for antimicrobial drug development through several strategic approaches:

  • Target Validation and Essentiality:

    • Determine whether aas is essential for S. boydii serotype 18 viability or virulence

    • Conduct gene knockout studies to assess growth defects and pathogenicity changes

    • Evaluate fitness costs in various environmental conditions to identify dependencies

  • Structure-Based Drug Design:

    • Utilize the amino acid sequence data for homology modeling

    • Identify catalytic pockets and substrate binding sites

    • Apply molecular docking to screen virtual compound libraries

    • Design inhibitors that specifically target the 2-acylglycerophosphoethanolamine acyltransferase activity

  • Rational Inhibitor Development:

    • Synthesize substrate analogs as competitive inhibitors

    • Develop transition-state mimetics targeting catalytic mechanisms

    • Create allosteric inhibitors that disrupt protein conformation

  • Translational Research Strategies:

    • Establish assay systems for high-throughput screening

    • Develop cellular assays to confirm target engagement

    • Evaluate effects on bacterial membrane integrity and composition

    • Assess specificity against homologous proteins in human cells

  • Combination Therapy Approaches:

    • Identify synergistic interactions with existing antibiotics

    • Target multiple membrane biosynthesis pathways simultaneously

    • Develop dual-action molecules affecting both aas and other bacterial targets

  • Resistance Mitigation Strategies:

    • Identify potential resistance mechanisms through evolutionary studies

    • Design inhibitor series with different binding modes

    • Target highly conserved residues less prone to mutation

This structure-function understanding could lead to novel antimicrobials targeting membrane phospholipid metabolism, potentially addressing urgent needs for new antibiotics against multi-drug resistant Shigella strains, which represent a significant global health challenge.

How might systems biology approaches enhance our understanding of Bifunctional protein aas in the broader context of S. boydii metabolism?

Systems biology approaches offer powerful frameworks for understanding Bifunctional protein aas within the broader metabolic network of S. boydii:

  • Multi-omics Integration:

    • Genomics: Analyze gene neighborhood and regulatory elements of the aas gene

    • Transcriptomics: Examine co-expression patterns under various conditions

    • Proteomics: Identify protein-protein interactions involving aas

    • Metabolomics: Track changes in membrane lipid composition

    • Fluxomics: Measure metabolic fluxes through phospholipid pathways

  • Network Analysis Methodologies:

    • Construct metabolic networks focusing on phospholipid metabolism

    • Identify regulatory networks controlling aas expression

    • Map protein interaction networks connecting aas to other cellular components

    • Develop pathway enrichment analyses to identify system-wide effects of aas perturbation

  • Computational Modeling Approaches:

    • Develop constraint-based models (flux balance analysis)

    • Create ordinary differential equation models of membrane lipid dynamics

    • Implement agent-based models of membrane biogenesis

    • Design machine learning algorithms to predict physiological impacts of aas modifications

  • Experimental Validation Strategies:

    • Generate aas knockout/knockdown strains and perform multi-omics characterization

    • Create reporter systems to monitor pathway activities in real-time

    • Implement CRISPRi screens to identify genetic interactions

    • Develop biosensors for detecting changes in membrane composition

  • Physiological Context Integration:

    • Examine the role of aas during different growth phases

    • Analyze function during host infection processes

    • Investigate environmental stress responses

    • Study contributions to biofilm formation and community dynamics

These systems-level approaches would place Bifunctional protein aas in its proper physiological context, revealing how this enzyme coordinates with other cellular processes to maintain membrane homeostasis and support pathogenicity in S. boydii serotype 18.

What are the potential applications of protein engineering to modify Bifunctional protein aas for biotechnological purposes?

Protein engineering of Bifunctional protein aas presents several promising biotechnological applications:

  • Enhanced Enzyme Properties:

    • Improve thermal stability for industrial applications

    • Increase solubility to facilitate large-scale production

    • Modify pH optima to function in various process conditions

    • Engineer substrate specificity for novel lipid modifications

  • Biosynthetic Applications:

    • Design variants capable of producing novel phospholipids with industrial value

    • Engineer pathways for bioproduction of specialty lipids

    • Develop systems for in vitro lipid remodeling

    • Create enzymatic cascades for complex lipid synthesis

  • Diagnostic Tool Development:

    • Engineer protein variants with enhanced antigenicity for improved diagnostics

    • Develop activity-based probes for lipid metabolism studies

    • Create fluorescent fusion proteins for imaging membrane dynamics

    • Design biosensors that detect specific lipid compositions

  • Therapeutic Applications:

    • Develop attenuated vaccine strains with modified aas activity

    • Engineer delivery systems for membrane-active drugs

    • Create inhibitor screening platforms

    • Design probes for studying host-pathogen membrane interactions

  • Methodological Approaches:

    • Directed evolution to generate improved variants

    • Rational design based on structural information

    • Semi-rational approaches combining computational prediction with experimental screening

    • Domain swapping with other acyltransferases to create chimeric enzymes

  • Production Optimization:

    • Codon optimization for expression in various systems

    • Signal sequence modifications for various targeting strategies

    • Fusion tags to enhance stability and purification efficiency

    • Scale-up strategies for industrial applications

These engineering approaches could transform this bacterial enzyme into valuable biotechnological tools for applications ranging from lipid biochemistry research to industrial biocatalysis and diagnostic development.

How might cutting-edge structural biology techniques advance our understanding of Bifunctional protein aas function and regulation?

Cutting-edge structural biology techniques offer unprecedented opportunities to advance our understanding of Bifunctional protein aas:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Visualize the full-length protein at near-atomic resolution

    • Capture different conformational states representing various functional stages

    • Examine membrane integration without crystallization

    • Visualize protein-substrate complexes in native-like environments

  • Integrative Structural Biology:

    • Combine X-ray crystallography, NMR, and Cryo-EM data

    • Incorporate small-angle X-ray scattering (SAXS) for solution dynamics

    • Use cross-linking mass spectrometry to validate structural models

    • Implement computational modeling to fill experimental gaps

  • Time-Resolved Structural Studies:

    • Apply time-resolved X-ray crystallography to capture catalytic intermediates

    • Use temperature-jump methods coupled with spectroscopy

    • Implement stopped-flow techniques with structural readouts

    • Develop single-molecule FRET sensors to monitor conformational changes

  • In Situ Structural Biology:

    • Apply cryo-electron tomography to visualize aas in bacterial membranes

    • Use correlative light and electron microscopy to localize and characterize the protein

    • Implement expansion microscopy for super-resolution imaging

    • Develop proximity labeling approaches to map local environments

  • Dynamics and Simulation:

    • Perform molecular dynamics simulations in membrane environments

    • Apply enhanced sampling methods to explore conformational landscapes

    • Use Markov state modeling to identify functionally relevant states

    • Simulate enzyme-substrate interactions over catalytically relevant timescales

  • Membrane Protein-Specific Approaches:

    • Utilize lipid nanodiscs for stabilization and structural studies

    • Apply native mass spectrometry to study membrane protein complexes

    • Implement solid-state NMR for membrane-embedded structural analysis

    • Use hydrogen-deuterium exchange mass spectrometry to map dynamics

These advanced structural approaches would provide unprecedented insights into how Bifunctional protein aas coordinates its dual enzymatic activities, interacts with membrane environments, and undergoes conformational changes during catalysis, potentially revealing new targets for inhibitor design and opportunities for protein engineering.

What are the most promising research directions for advancing our understanding of Shigella boydii serotype 18 Bifunctional protein aas?

Based on the current state of knowledge, several high-priority research directions emerge for advancing our understanding of S. boydii serotype 18 Bifunctional protein aas:

  • Structure-Function Characterization:

    • Determine high-resolution structures of the protein in different functional states

    • Map the catalytic sites for both enzymatic activities

    • Investigate membrane integration and topology

    • Examine interaction with substrates and other membrane components

  • Physiological Role Assessment:

    • Create knockout and conditional mutants to assess essentiality

    • Investigate changes in membrane composition and integrity in mutants

    • Determine impacts on stress responses and environmental adaptation

    • Analyze effects on virulence and host interaction

  • Regulatory Network Mapping:

    • Identify transcriptional and post-transcriptional regulatory mechanisms

    • Determine environmental signals that modulate expression

    • Investigate protein-level regulation including potential post-translational modifications

    • Explore coordination with other membrane biogenesis pathways

  • Pathogenesis Connections:

    • Evaluate the relationship between aas function and O antigen presentation

    • Assess contribution to intracellular survival

    • Investigate role in immune evasion

    • Determine impacts on antimicrobial resistance

  • Translational Applications:

    • Develop diagnostic tools based on aas-specific detection

    • Screen for potential inhibitors as antimicrobial candidates

    • Explore vaccine antigen potential

    • Create research tools for membrane biology studies

These research directions would significantly advance both fundamental understanding of bacterial membrane biology and practical applications in diagnostics, therapeutics, and biotechnology related to this important pathogen.

What multidisciplinary approaches could best address the complex questions surrounding this protein and its role in bacterial physiology?

Addressing the complex questions surrounding Bifunctional protein aas requires integrated multidisciplinary approaches:

  • Integrative Structural Biology and Biophysics:

    • Combine crystallography, Cryo-EM, and NMR spectroscopy

    • Implement molecular dynamics simulations

    • Analyze protein dynamics through spectroscopic methods

    • Apply label-free techniques to study protein-lipid interactions

  • Systems and Synthetic Biology:

    • Develop genome-scale metabolic models incorporating lipid metabolism

    • Create synthetic gene circuits to probe regulatory networks

    • Apply multi-omics integration approaches

    • Design minimal systems reconstituting membrane biogenesis

  • Chemical Biology and Biochemistry:

    • Synthesize activity-based probes for enzyme function

    • Develop chemical genetic approaches for target validation

    • Create selective inhibitors as chemical tools

    • Apply metabolic labeling to track phospholipid dynamics

  • Advanced Microbiology and Molecular Genetics:

    • Implement CRISPR-based genetic manipulation

    • Develop high-throughput phenotypic screening methods

    • Create reporter strains for monitoring in vivo activity

    • Apply directed evolution approaches

  • Computational and Data Science:

    • Implement machine learning for pattern recognition in multi-omics data

    • Develop predictive models of membrane dynamics

    • Apply network analysis to contextualizing protein function

    • Create visualization tools for complex datasets

  • Infection Biology and Immunology:

    • Study host-pathogen interactions in advanced model systems

    • Investigate immune recognition and evasion strategies

    • Develop ex vivo tissue models

    • Explore microbiome interactions

  • Collaborative Research Framework:

    • Establish interdisciplinary research teams

    • Develop standardized protocols for reproducibility

    • Create shared databases of experimental results

    • Implement open science practices for accelerated discovery

This multidisciplinary approach would create a comprehensive understanding of how Bifunctional protein aas functions within the complex biological context of bacterial physiology and pathogenesis.

What technological developments are needed to overcome current limitations in studying membrane-associated bifunctional enzymes like aas?

Several technological developments are needed to overcome current limitations in studying membrane-associated bifunctional enzymes like aas:

  • Membrane Protein Structural Biology Advances:

    • Develop improved membrane mimetics beyond detergent micelles

    • Create better crystallization techniques for membrane proteins

    • Enhance cryo-EM methods for smaller membrane proteins

    • Implement advanced computational approaches for modeling membrane environments

  • In Situ Characterization Tools:

    • Develop methods to study enzymes directly in native membranes

    • Improve spatial resolution of imaging techniques for subcellular localization

    • Create sensors for real-time activity monitoring in live bacteria

    • Implement correlative microscopy approaches linking structure and function

  • Lipid Analysis Technologies:

    • Improve sensitivity of mass spectrometry for membrane lipid detection

    • Develop single-cell lipidomics approaches

    • Create spatially resolved lipid analysis methods

    • Implement high-throughput screening of lipid modifications

  • Protein Engineering Platforms:

    • Develop improved expression systems for membrane proteins

    • Create better fusion partners for stabilization

    • Implement automated systems for membrane protein purification

    • Design directed evolution approaches specific to membrane enzymes

  • Functional Assay Development:

    • Design high-throughput approaches for bifunctional enzyme characterization

    • Create better fluorescent and luminescent reporters for activity

    • Implement label-free detection methods for real-time kinetics

    • Develop microfluidic platforms for enzyme characterization

  • Computational Methods:

    • Improve algorithms for membrane protein structure prediction

    • Develop better force fields for membrane protein simulations

    • Create integrated models incorporating multiple experimental datasets

    • Implement machine learning approaches for predicting protein-lipid interactions

  • Genetic Tool Optimization:

    • Refine CRISPR systems for precise membrane protein engineering

    • Develop better inducible expression systems for toxic membrane proteins

    • Create genetic screens specific for membrane protein function

    • Implement site-specific incorporation of unnatural amino acids for probe attachment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.