Recombinant Shigella boydii serotype 18 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cardiolipin Synthesis

Cardiolipin synthase catalyzes the transfer of phosphatidyl groups to phosphatidylglycerol, forming cardiolipin. This phospholipid is essential for bacterial membrane integrity, particularly in the inner membrane and outer membrane localization of virulence factors .

Key Research Findings

Research Applications

The recombinant cls protein is utilized in:

  1. Enzymatic Studies: To study cardiolipin biosynthesis kinetics and substrate specificity.

  2. Immunological Assays: As an antigen in ELISA kits for detecting anti-Shigella antibodies .

  3. Genetic Engineering: For constructing cls deletion mutants to investigate cardiolipin’s role in bacterial pathogenesis .

ApplicationMethodOutcome
Gene CloningMini-F vector insertion in E. coli Identification of cls as cardiolipin synthase gene
Mutant Constructionλ-Red-mediated recombination Analysis of cardiolipin’s role in virulence

Comparative Insights from Related Species

While S. boydii cls remains understudied, insights from S. flexneri and E. coli provide context:

SpeciesCardiolipin SynthaseFunctionSource
E. coli K-12clsMajor cardiolipin synthase
S. flexnericlsAPrimary enzyme during exponential growth
S. flexnericlsCActive during stationary phase

These findings suggest conserved enzymatic roles across Shigella species, with clsA likely being the primary synthase in S. boydii .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
clsA; cls; SbBS512_E1418; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEIVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWHRVAERLFY FFSPLL
Uniprot No.

Target Background

Function
This enzyme catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase in Shigella boydii and what is its role?

Cardiolipin synthase (cls) in Shigella boydii is an enzyme responsible for synthesizing cardiolipin, a crucial phospholipid in bacterial membranes. Similar to what has been observed in Shigella flexneri, cardiolipin is likely synthesized primarily by ClsA in S. boydii, which condenses two phosphatidylglycerol molecules to form cardiolipin . Cardiolipin is essential for maintaining membrane integrity and plays a critical role in bacterial virulence mechanisms. In S. flexneri, cardiolipin synthesis is required for successful intercellular spread and plaque formation in epithelial cell monolayers, indicating its importance in pathogenesis .

How many cardiolipin synthase genes are present in Shigella species and what are their functions?

Shigella species typically possess three cardiolipin synthase genes, similar to what has been characterized in S. flexneri and E. coli. These genes are:

  • clsA (also called cls) - The primary cardiolipin synthase during exponential growth

  • clsB (also called ybhO) - A secondary cardiolipin synthase with minor activity

  • clsC (also called ymdC) - Contributes to cardiolipin synthesis primarily during stationary phase

Based on research with S. flexneri, ClsA appears to be the major cardiolipin synthase, as its deletion results in undetectable levels of cardiolipin during exponential growth phase and significantly reduced levels during stationary phase .

How is Shigella boydii serotype 18 classified taxonomically and what distinguishes it from other Shigella species?

Shigella boydii serotype 18 belongs to the genus Shigella, which consists of Gram-negative, non-spore-forming, non-motile, facultative aerobic rod-shaped bacteria . Shigella species are classified into four main groups: S. dysenteriae, S. flexneri, S. boydii, and S. sonnei. S. boydii is further divided into multiple serotypes based on O-antigen structures, with serotype 18 being one specific variant. While S. flexneri is the most frequently isolated species worldwide (accounting for approximately 60% of Shigella infections), S. boydii has unique O-antigen structures that contribute to its serological distinctiveness . The strain CDC 3083-94 / BS512 is a well-characterized representative of S. boydii serotype 18.

What are the structural and functional differences between cardiolipin synthases from different Shigella species?

  • Enzyme activity profiles: In S. flexneri, ClsA is the predominant cardiolipin synthase during exponential growth, while ClsC contributes significantly during stationary phase . A similar differential activity pattern may exist in S. boydii serotype 18.

  • Substrate specificity: S. flexneri ClsA and ClsB condense two phosphatidylglycerol molecules, while ClsC condenses phosphatidylglycerol and phosphatidylethanolamine . The substrate preferences for S. boydii enzymes likely follow similar patterns but may have subtle differences affecting efficiency.

  • Regulation: Transcriptional analysis of S. flexneri shows that clsB and clsC are induced approximately 10-fold in intracellular bacteria, suggesting environment-specific regulation . S. boydii cls genes might exhibit similar regulatory patterns adapted to its particular niche.

What is the relationship between cardiolipin distribution and the pathogenesis of Shigella boydii infections?

The distribution of cardiolipin in bacterial membranes plays a crucial role in pathogenesis. In S. flexneri, cardiolipin is found in both inner and outer membranes, with similar distribution patterns . This distribution is critical for:

  • Surface protein localization: Proper localization of virulence factors like IcsA (actin polymerization protein) depends on cardiolipin in the outer membrane .

  • Intercellular spread: Cardiolipin in the outer membrane facilitates bacterial spread between host cells, a key virulence mechanism .

  • Environmental adaptation: The variable synthesis of cardiolipin by different synthases under different growth conditions suggests its role in adaptation to diverse environments encountered during infection.

For S. boydii, the cardiolipin distribution pattern is likely comparable, with both inner and outer membrane localization contributing to its pathogenic properties, though specific virulence factors affected may differ from those of S. flexneri.

What are the optimal expression systems for producing functional recombinant Shigella boydii cardiolipin synthase?

For optimal expression of recombinant S. boydii cardiolipin synthase, several expression systems can be considered:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, genetic similarity to Shigella, simple cultivationPotential inclusion body formation, may lack post-translational modificationsStructural studies, antibody production
YeastEukaryotic post-translational modifications, proper foldingLower yields than bacteria, more complex cultivationFunctional studies requiring proper folding
BaculovirusHigh expression levels, suitable for membrane proteinsTechnical complexity, higher costComplex functional studies, protein interaction studies
Mammalian CellMost sophisticated post-translational modificationsLowest yields, highest cost and complexityStudies requiring mammalian-specific modifications

Based on available information about recombinant S. boydii cls production, various expression systems including E. coli, yeast, baculovirus, and mammalian cells have been used . For basic structural studies and preliminary functional characterization, E. coli systems are typically most efficient due to genetic similarity between E. coli and Shigella.

What methods can be used to assess the enzymatic activity of recombinant Shigella boydii cardiolipin synthase?

Several complementary approaches can be employed to assess the enzymatic activity of recombinant S. boydii cardiolipin synthase:

  • Thin-layer chromatography (TLC): This method separates and visualizes phospholipids extracted using the Bligh-Dyer method, allowing quantification of cardiolipin and other phospholipids . For S. flexneri, TLC revealed that wild-type strains contain approximately 7% cardiolipin during exponential growth, increasing to 10% in stationary phase .

  • Membrane fractionation: Inner and outer membranes can be separated using Sarkosyl solubilization followed by phospholipid extraction and TLC analysis to determine the distribution of cardiolipin in different membrane compartments .

  • In vitro enzymatic assays: Purified recombinant enzyme can be incubated with substrates (phosphatidylglycerol) in appropriate buffer conditions, and product formation can be monitored using TLC or more sensitive mass spectrometry methods.

  • Complementation assays: The functional activity of recombinant S. boydii cls can be assessed by its ability to complement cardiolipin synthesis in ClsA-deficient bacterial strains, restoring both phospholipid profiles and virulence phenotypes .

How can genetic manipulation techniques be optimized for studying Shigella boydii cardiolipin synthase function?

Optimized genetic manipulation techniques for studying S. boydii cardiolipin synthase include:

  • Lambda RED recombination system: This highly efficient method enables precise gene replacement, as demonstrated in studies where genes were replaced with antibiotic resistance markers . For S. boydii cls studies, this approach allows targeted deletion of individual cardiolipin synthase genes by replacing them with selectable markers.

  • Plasmid-based complementation: Reintroducing cls genes on plasmids under native or inducible promoters can confirm phenotypes and allow structure-function studies through introduction of point mutations .

  • Gene-specific PCR primers: Primers that amplify cls genes can be designed based on flanking sequences, as demonstrated in studies of S. boydii O-antigen genes . For example, primers carrying 36 bp homology to sequences flanking the target gene can be used to generate PCR products for RED recombination .

  • Inducible expression systems: For studying toxic gene products or for temporal control of gene expression, inducible promoters can be employed, similar to the approach used for inducing RED genes in genetic manipulation protocols .

How can recombinant Shigella boydii cardiolipin synthase be used to study bacterial membrane biogenesis?

Recombinant S. boydii cardiolipin synthase provides a valuable tool for studying bacterial membrane biogenesis through several approaches:

  • Reconstitution studies: Purified recombinant enzyme can be incorporated into artificial membrane systems to study the biophysical effects of cardiolipin synthesis on membrane curvature, fluidity, and domain formation.

  • Temporal regulation studies: Using inducible expression systems, researchers can trigger cardiolipin synthesis at specific time points to observe dynamic membrane remodeling processes.

  • Interaction studies: Tagged recombinant cls can identify protein interaction partners involved in coordinated membrane biogenesis, potentially revealing novel components of lipid transport and membrane organization.

  • Comparative analysis: The function of S. boydii cls can be compared with enzymes from other bacterial species to understand evolutionary adaptations in membrane composition related to pathogenesis.

What insights can be gained from studying cardiolipin synthase mutants in Shigella boydii compared to other Shigella species?

Comparative analysis of cardiolipin synthase mutants across Shigella species offers multiple research insights:

  • Species-specific virulence mechanisms: S. flexneri clsA mutants show defects in intercellular spread and plaque formation . Similar studies in S. boydii could reveal whether cardiolipin plays identical or distinct roles in its pathogenesis.

  • Niche adaptation: Different Shigella species preferentially infect different intestinal regions. Comparing the phenotypes of cls mutants could illuminate how cardiolipin contributes to these niche preferences.

  • Compensatory mechanisms: In S. flexneri, loss of cardiolipin leads to increased phosphatidylglycerol levels . Species-specific differences in these compensatory responses might reveal alternative membrane adaptation strategies.

  • Evolutionary insights: The four Shigella species evolved independently from different E. coli ancestors. Comparing how cardiolipin function diverged across these lineages could provide insights into the parallel evolution of pathogenicity.

What is the potential for targeting cardiolipin synthase in antimicrobial development against Shigella infections?

Cardiolipin synthase represents a promising antimicrobial target for several reasons:

  • Essential for virulence: S. flexneri clsA mutants show severely attenuated virulence while maintaining normal growth in vitro , suggesting that cls inhibitors could act as anti-virulence agents rather than growth inhibitors, potentially reducing selection pressure for resistance.

  • Broadly conserved: Cardiolipin synthases are present across Shigella species and other pathogenic bacteria, offering potential for broad-spectrum activity.

  • Unique aspects compared to host enzymes: Bacterial cardiolipin synthesis differs from eukaryotic pathways, potentially allowing selective targeting.

  • Multiple cellular processes affected: Inhibiting cardiolipin synthesis impacts multiple aspects of bacterial physiology, including membrane organization, protein localization, and stress responses, making adaptation more difficult.

Potential screening approaches for cls inhibitors could include enzymatic assays with purified recombinant enzyme, whole-cell assays measuring membrane cardiolipin content, and phenotypic screens for compounds that inhibit intercellular spread without affecting growth.

What are the current knowledge gaps in understanding Shigella boydii cardiolipin synthase function?

Despite progress in understanding cardiolipin synthesis in Shigella species, several knowledge gaps remain:

  • Serotype-specific differences: While cardiolipin synthase function has been characterized in S. flexneri, detailed studies of S. boydii serotype 18 cls are lacking, particularly regarding its role in this specific pathogen's virulence mechanisms.

  • Regulatory networks: The transcriptional and post-translational regulation of cardiolipin synthases in response to environmental cues encountered during infection remains poorly understood.

  • Structural information: High-resolution structural data for S. boydii cardiolipin synthase is unavailable, limiting structure-based approaches to understand its mechanism and develop inhibitors.

  • Host-pathogen interactions: How cardiolipin in the bacterial outer membrane influences interactions with host immune receptors and membranes requires further investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.