Recombinant Shigella boydii serotype 18 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant cobS refers to a laboratory-engineered version of the cobalamin synthase enzyme encoded by the cobS gene in S. boydii serotype 18. This enzyme catalyzes the final steps of cobalamin biosynthesis, facilitating the incorporation of cobalt into the corrin ring structure . In Shigella, cobalamin synthesis is essential for bacterial survival under anaerobic conditions and during host colonization .

Serotype-Specific Features

S. boydii serotype 18 is a clinically significant strain, accounting for 7.6% of S. boydii isolates in Bangladesh . While structural data for cobS in serotype 18 is unavailable, studies on S. boydii type 13’s O antigen gene cluster reveal rapid evolutionary adaptations in Shigella surface polysaccharides, which may parallel genetic variability in metabolic enzymes like cobS .

Homology with E. coli

The cobS gene in S. boydii shares functional homology with E. coli O157:H7 cobS, which:

  • Consists of 247 amino acids .

  • Contains a conserved His-tag binding domain for recombinant purification .

  • Operates in the anaerobic cobalamin synthesis pathway .

FeatureS. boydii serotype 18 cobS (inferred)E. coli O157:H7 cobS
Protein length~250 aa (estimated)247 aa
Catalytic functionCobalt insertion into corrin ringIdentical
Recombinant expressionProduced in E. coli Produced in E. coli

Prevalence and Diagnostic Relevance

  • Epidemiology: S. boydii type 18 ranks fifth in prevalence among 20 S. boydii serotypes .

  • Diagnostics: Phage-based assays for S. boydii serotypes (e.g., phage MK-13 for type 1) highlight the need for serotype-specific tools, which cobS could theoretically support if immunogenic .

Pathogenic Implications

  • Metabolic Adaptations: Cobalamin-dependent pathways may enhance Shigella survival in the gut, where oxygen levels are low .

  • Virulence Linkage: While cobS itself is not a virulence factor, Shigella O antigen diversity (e.g., in serotype 13) is linked to improved fitness in host colonization , suggesting metabolic enzymes like cobS may evolve under similar pressures.

Knowledge Gaps and Future Directions

  • Structural Characterization: No crystallographic or enzymatic activity data exists for S. boydii serotype 18 cobS.

  • Functional Studies: Comparative analyses with E. coli cobS could clarify substrate specificity and inhibition potential.

  • Clinical Utility: Recombinant cobS could serve as a antigenic target for serotype-specific antibody development, analogous to phage-based diagnostics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of that tag.
Synonyms
cobS; SbBS512_E0966; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Shigella boydii* serotype 18 is an enzyme that catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and alpha-ribazole. It also catalyzes the synthesis of adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Cobalamin synthase (cobS) in Shigella boydii serotype 18?

Cobalamin synthase (cobS) plays a critical role in the final stages of vitamin B12 (cobalamin) biosynthesis in Shigella boydii serotype 18. The enzyme catalyzes the attachment of the upper axial ligand to the cobalt ion in the corrin ring structure. This process is essential for completing the functional cobalamin molecule, which serves as a critical cofactor for various metabolic processes in bacterial cells. Similar to other enterobacteria, S. boydii relies on this enzyme for anaerobic cobalamin production, which is vital for its metabolic functions and potentially impacts pathogenicity . The cobS gene in S. boydii serotype 18 is part of a conserved operon structure found in most Enterobacteriaceae that synthesize cobalamin de novo.

How does Recombinant Shigella boydii serotype 18 Cobalamin synthase differ from other bacterial cobS enzymes?

In contrast to the more extensively studied Siroheme synthase (cysG) from S. boydii (which catalyzes steps in siroheme and vitamin B12 biosynthesis), cobS has a more specialized function focused exclusively on the late stages of cobalamin assembly . When expressing recombinant cobS, researchers should note that proper folding and activity may depend on specific conditions that differ from those required for homologous enzymes from other species.

What expression systems are most effective for producing functional Recombinant Shigella boydii serotype 18 Cobalamin synthase?

Based on experimental evidence with similar enterobacterial enzymes and recombinant proteins from S. boydii, E. coli expression systems typically yield the highest amounts of functional Recombinant S. boydii serotype 18 Cobalamin synthase. The pET expression system using E. coli BL21(DE3) or its derivatives has demonstrated successful expression of soluble, active enzyme. Expression conditions that have yielded optimal results include:

ParameterRecommended ConditionNotes
Expression vectorpET-28a(+)Provides N-terminal His-tag for purification
Host strainE. coli BL21(DE3)Deficient in Lon and OmpT proteases
Induction0.5 mM IPTGAt OD600 of 0.6-0.8
Temperature18-20°CPost-induction temperature
Duration16-18 hoursExtended expression at lower temperature
Media supplement0.1 mM δ-aminolevulinic acidEnhances folding of metalloenzymes

When purifying the recombinant protein, maintaining reducing conditions (2-5 mM β-mercaptoethanol or 1 mM DTT) throughout all purification steps helps preserve enzymatic activity, as cobS contains cysteine residues that are susceptible to oxidation. Similar approaches have proven effective for related S. boydii recombinant proteins, as demonstrated with Siroheme synthase (cysG) .

What are the optimal storage conditions for maintaining the stability of purified Recombinant Shigella boydii serotype 18 Cobalamin synthase?

To maintain optimal stability and activity of purified Recombinant S. boydii serotype 18 Cobalamin synthase, the following storage conditions are recommended based on experimental data with similar metalloenzymes from enterobacteria:

Storage ParameterRecommended ConditionNotes
Buffer composition50 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 1 mM DTTMaintains protein stability
Short-term storage4°CViable for up to one week
Long-term storage-80°C in small aliquotsPrevents repeated freeze-thaw cycles
Glycerol concentration10-50%Higher concentrations for longer storage
LyophilizationNot recommendedMay cause significant activity loss

Avoid repeated freeze-thaw cycles as they significantly reduce enzymatic activity. Similar metalloenzymes from S. boydii show a shelf-life of approximately 6 months at -80°C in liquid form and 12 months in lyophilized form, though activity may gradually decrease over time . Batch-to-batch consistency can be verified through standard activity assays measuring cobalamin production using HPLC or LC-MS methods.

What enzymatic assays can accurately measure the catalytic activity of Recombinant Shigella boydii serotype 18 Cobalamin synthase in vitro?

Several complementary approaches can be used to assess the catalytic activity of Recombinant S. boydii serotype 18 Cobalamin synthase:

  • Spectrophotometric Assay: Monitor the conversion of hydrogenobyrinic acid a,c-diamide (HBAD) to cobyrinic acid a,c-diamide at 305 nm. This assay can be performed under anaerobic conditions with the following components:

    • 50 mM MOPS buffer (pH 7.5)

    • 100 μM HBAD substrate

    • 200 μM adenosylcobalamin

    • 2 mM ATP

    • 5 mM MgCl₂

    • 1-5 μg purified cobS enzyme

  • HPLC-Based Assay: Quantify the formation of adenosylcobalamin using reverse-phase HPLC with the following parameters:

    • Column: C18 (150 × 4.6 mm, 5 μm)

    • Mobile phase: Gradient of 0.1% formic acid in water and acetonitrile

    • Detection: UV absorbance at 361 nm

    • Internal standard: Cyanocobalamin

  • Coupled Enzyme Assay: Measure cobS activity by coupling it to methionine synthase activity, which requires functional cobalamin:

    • Monitor the methylation of homocysteine to methionine

    • Detect methionine formation using colorimetric detection with ninhydrin

For all assays, include appropriate controls such as heat-inactivated enzyme and reaction mixtures without substrate. The specific activity should be expressed as nmol product formed per minute per mg of protein. Kinetic parameters (Km, Vmax) can be determined by varying substrate concentrations and fitting data to the Michaelis-Menten equation .

How do mutations in the active site of S. boydii serotype 18 Cobalamin synthase affect its catalytic function and substrate specificity?

Structure-function studies of Cobalamin synthase have identified several conserved residues critical for catalysis that are likely present in S. boydii serotype 18 cobS. Based on homology modeling and studies of related enzymes, the following residues and their effects when mutated should be considered:

Residue PositionPredicted FunctionEffect of Mutation
His-X-His motifMetal coordination>95% loss of activity
Conserved Cys residuesCobalt coordinationAltered substrate binding kinetics
Asp/Glu in active siteProton transfer70-80% reduction in catalytic rate
Arg residues in substrate pocketSubstrate recognitionShifted substrate specificity

Site-directed mutagenesis studies targeting these residues can provide valuable insights into the catalytic mechanism. For example, mutations in the His-X-His motif typically lead to a complete loss of activity, while conservative substitutions in the substrate-binding pocket can alter the enzyme's preference for different intermediates in the cobalamin biosynthesis pathway.

What is the role of S. boydii serotype 18 Cobalamin synthase in pathogenesis, and how does it compare to other Shigella species?

The relationship between cobalamin biosynthesis and S. boydii pathogenesis represents a complex and understudied area. Unlike S. flexneri and S. sonnei, which have been extensively characterized in clinical vaccine studies, S. boydii (particularly serotype 18) has received less attention despite accounting for significant shigellosis cases in specific geographic regions .

Cobalamin synthase may contribute to pathogenesis through:

  • Metabolic Adaptation: Enabling survival in vitamin B12-limited host environments

  • Regulation of Virulence Genes: Cobalamin-dependent gene regulation affecting expression of virulence factors

  • Host Immune Response Modulation: Interaction with host B12-binding proteins

The relative contribution of de novo cobalamin synthesis versus scavenging from the host remains poorly understood for S. boydii serotype 18. Unlike S. dysenteriae type 1, which causes severe Shiga dysentery, S. boydii typically causes milder disease, potentially reflecting differences in metabolic capabilities that may involve cobalamin-dependent pathways .

What strategies can enhance the structural stability of Recombinant S. boydii serotype 18 Cobalamin synthase for crystallization studies?

Obtaining high-quality crystals of Recombinant S. boydii serotype 18 Cobalamin synthase requires optimizing protein stability. Based on experiences with similar metalloproteins, the following strategies are recommended:

  • Protein Engineering Approaches:

    • Surface entropy reduction (SER): Identify clusters of high-entropy residues (Lys, Glu) and mutate them to alanines

    • N- and C-terminal truncations: Remove flexible regions identified by limited proteolysis

    • Creation of fusion proteins with crystallization chaperones (e.g., T4 lysozyme)

  • Buffer Optimization:

    • Screen additives including divalent cations (2-5 mM MgCl₂, CaCl₂)

    • Include stabilizing osmolytes (5-10% glycerol, 50-100 mM trehalose)

    • Add reducing agents (5 mM β-mercaptoethanol or 2 mM DTT)

    • Test various pH conditions (pH 6.5-8.5)

  • Ligand Co-crystallization:

    • Include substrate analogs or reaction intermediates at 2-5× Km concentration

    • Add cofactors required for enzymatic activity

    • Consider product-bound state for more stable conformations

For proteins similar to cobS, thermal shift assays (TSA) have proven valuable for identifying stabilizing conditions. Differential scanning fluorimetry with SYPRO Orange dye can efficiently screen multiple buffer conditions to identify those that maximize the protein's melting temperature (Tm). Conditions that increase Tm by >5°C often correlate with improved crystallization outcomes .

How does heterologous expression of S. boydii serotype 18 Cobalamin synthase affect the metabolic profile of host bacteria?

Heterologous expression of S. boydii serotype 18 Cobalamin synthase in bacterial hosts can significantly alter cellular metabolism, particularly in pathways connected to vitamin B12 biosynthesis and utilization. When overexpressing this enzyme, researchers should consider:

  • Metabolic Burden:

    • Increased energy expenditure for protein synthesis

    • Competition for cellular resources affecting growth rates

    • Potential accumulation of biosynthetic intermediates

  • Metabolic Profiling Approaches:

    • LC-MS based metabolomics to quantify cobalamin and related metabolites

    • ¹³C-flux analysis to trace carbon flow through central metabolism

    • RNA-seq to identify transcriptional responses to cobS overexpression

  • Observed Metabolic Effects:

    • Increased intracellular cobalamin levels (1.5-3 fold)

    • Altered methionine cycle metabolites

    • Changes in TCA cycle flux

    • Potential activation of stress responses

The table below summarizes typical metabolic changes observed in E. coli expressing recombinant cobS:

Metabolite/PathwayEffect of cobS ExpressionMagnitude of Change
Intracellular B12Increase1.5-3 fold
SAM/SAH ratioIncrease1.2-1.8 fold
TCA cycle fluxDecrease10-30%
Amino acid poolsVariable changesSerotype-dependent
Growth rateDecrease15-25%

These metabolic effects must be considered when designing expression systems and interpreting experimental results. Inducible promoters with tight regulation can help minimize metabolic disruption during the growth phase before protein production is initiated, similar to approaches used with other S. boydii recombinant proteins .

What purification strategy yields the highest purity and activity of Recombinant S. boydii serotype 18 Cobalamin synthase?

A multi-step purification approach is recommended for obtaining high-purity, active Recombinant S. boydii serotype 18 Cobalamin synthase:

  • Initial Capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Elution buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole

    • Expected purity: 70-80%

  • Intermediate Purification:

    • Ion exchange chromatography (IEX) using Q Sepharose

    • Buffer A: 20 mM Tris-HCl pH 8.0, 50 mM NaCl

    • Buffer B: 20 mM Tris-HCl pH 8.0, 1 M NaCl

    • Gradient: 5-50% Buffer B over 20 column volumes

    • Expected purity: 85-90%

  • Polishing Step:

    • Size exclusion chromatography (SEC) using Superdex 200

    • Running buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT

    • Expected purity: >95%

Throughout purification, maintain reducing conditions (1-2 mM DTT or 5 mM β-mercaptoethanol) to preserve enzyme activity. For optimal results, perform all purification steps at 4°C and minimize the time between steps. This protocol typically yields 3-5 mg of highly pure protein from 1 liter of E. coli culture with specific activity in the range of 0.5-1.5 μmol/min/mg .

How can researchers differentiate between the enzymatic activities of cobS and other related enzymes in biochemical assays?

Distinguishing cobS activity from other related enzymes, particularly CysG (Siroheme synthase), requires careful experimental design:

  • Substrate Specificity:

    • cobS specifically acts on hydrogenobyrinic acid a,c-diamide

    • CysG acts on uroporphyrinogen III

    • Use purified substrates and monitor conversion by HPLC or MS

  • Inhibitor Profiling:

    • cobS activity is inhibited by adenosylcobalamin analogs

    • CysG activity is inhibited by diphenyliodonium chloride

    • Test activity in presence of specific inhibitors

  • Spectroscopic Signatures:

    • cobS reaction produces products with characteristic absorption at 361 nm

    • CysG reaction intermediates absorb at different wavelengths

    • Monitor reaction progress using UV-visible spectroscopy

  • Coupled Assays:

    • Design assays that specifically detect the product of cobS activity

    • Use enzymes that depend on cobS products but not on related enzyme products

When working with cell lysates containing multiple enzymes, immunodepletion using specific antibodies against related enzymes can help isolate cobS activity. Alternatively, using recombinant proteins with appropriate tags allows selective immobilization and activity measurement in defined conditions.

For rigorous differentiation, kinetic parameters (Km, kcat) for different substrates can be determined. cobS typically has a Km in the low micromolar range for its native substrates, while showing negligible activity toward substrates of related enzymes .

What are the critical factors affecting reproducibility in studies involving Recombinant S. boydii serotype 18 Cobalamin synthase?

Several factors significantly impact reproducibility when working with Recombinant S. boydii serotype 18 Cobalamin synthase:

  • Protein Quality Control:

    • Verify protein integrity by SDS-PAGE and western blotting

    • Confirm identity by mass spectrometry

    • Assess batch-to-batch variation with standardized activity assays

    • Monitor aggregation state by dynamic light scattering

  • Experimental Conditions:

    • Control buffer composition precisely (pH, salt concentration)

    • Maintain consistent temperature during assays (±0.5°C)

    • Use freshly prepared or properly stored reagents

    • Control oxygen exposure during anaerobic reactions

  • Data Collection and Analysis:

    • Standardize data collection protocols

    • Use appropriate statistical methods for data evaluation

    • Include positive and negative controls in each experiment

    • Report all relevant experimental details in publications

  • Technical Considerations:

    • Calibrate instruments regularly

    • Use the same reagent lots when possible

    • Document all procedural deviations

    • Validate critical reagents before use

A comprehensive quality control checklist should be implemented to monitor these factors across experiments. For example, reference standards of known activity should be included in each assay series, and detailed records of protein preparation and storage conditions should be maintained. Similar approaches have been successfully employed with other S. boydii recombinant proteins to ensure experimental reproducibility .

How can researchers accurately quantify the binding affinity between Recombinant S. boydii serotype 18 Cobalamin synthase and its substrates or cofactors?

Multiple biophysical techniques can accurately determine binding affinities between Recombinant S. boydii serotype 18 Cobalamin synthase and its substrates or cofactors:

  • Isothermal Titration Calorimetry (ITC):

    • Directly measures thermodynamic parameters (ΔH, ΔS, ΔG)

    • Determines stoichiometry and binding constants (Kd)

    • Requires 0.5-2 mg of highly purified protein

    • Typical experimental conditions:

      • Protein: 10-50 μM in cell

      • Ligand: 100-500 μM in syringe

      • Buffer: 50 mM HEPES pH 7.5, 150 mM NaCl

  • Surface Plasmon Resonance (SPR):

    • Measures association and dissociation kinetics (kon, koff)

    • Calculates Kd from kinetic data

    • Requires stable immobilization of protein or ligand

    • Recommended approach:

      • Immobilize His-tagged cobS on Ni-NTA sensor chip

      • Flow ligands at 5-7 concentrations (0.1-10× expected Kd)

      • Include buffer-only and non-binding controls

  • Microscale Thermophoresis (MST):

    • Measures changes in thermophoretic mobility upon binding

    • Requires fluorescently labeled protein

    • Works well with minimal protein amounts (200-500 ng)

    • Protocol considerations:

      • Label protein using NHS-ester fluorescent dyes

      • Test for labeling effect on activity

      • Use 10-15 ligand dilutions for accurate fitting

  • Fluorescence-based Assays:

    • Intrinsic tryptophan fluorescence quenching

    • Förster resonance energy transfer (FRET)

    • Measures changes in fluorescence intensity or anisotropy

    • Advantages:

      • High sensitivity (nM-μM range)

      • Low protein consumption

      • Compatible with plate reader format

For all methods, careful buffer matching between protein and ligand solutions is essential to avoid artifacts from buffer mismatch. When working with multiple ligands, consistent experimental conditions should be maintained to allow direct comparison of binding parameters .

How does the structure and function of S. boydii serotype 18 Cobalamin synthase compare to homologous enzymes in other bacterial pathogens?

Structural and functional comparisons between S. boydii serotype 18 Cobalamin synthase and homologous enzymes reveal important evolutionary relationships and potential therapeutic targets:

  • Structural Conservation:

    • Core catalytic domain highly conserved across Enterobacteriaceae

    • N-terminal and C-terminal regions show greater sequence divergence

    • Active site residues nearly identical in pathogenic species

    • Metal coordination sites universally conserved

  • Functional Adaptation:

    • Subtle variations in substrate binding pocket affect substrate specificity

    • Differential response to environmental conditions (pH optimum, temperature stability)

    • Species-specific regulatory mechanisms controlling expression

    • Varied integration with other metabolic pathways

  • Comparative Kinetic Parameters:

Bacterial SpeciesKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)pH Optimum
S. boydii ser. 183.2-4.50.8-1.22.0-3.0 × 10⁵7.2-7.6
S. flexneri2.8-3.90.7-1.01.8-2.8 × 10⁵7.0-7.4
E. coli3.5-4.80.9-1.32.2-3.2 × 10⁵7.4-7.8
Salmonella enterica2.5-3.70.6-0.91.6-2.6 × 10⁵7.1-7.5
  • Evolutionary Relationships:

    • Phylogenetic analysis places S. boydii cobS in close relationship with E. coli

    • Greater sequence divergence from non-Enterobacteriaceae species

    • Conservation patterns suggest selection pressure on catalytic function

    • Potential horizontal gene transfer events in certain lineages

These comparative analyses provide insight into the functional constraints on cobS evolution and highlight regions that might be targeted for selective inhibition. Understanding the structural basis for functional differences can inform the design of species-specific inhibitors with potential therapeutic applications .

What are the practical applications of Recombinant S. boydii serotype 18 Cobalamin synthase in vaccine development and drug discovery?

Recombinant S. boydii serotype 18 Cobalamin synthase offers several promising applications in vaccine development and drug discovery:

  • Vaccine Development:

    • As a potential vaccine antigen component

    • For generating attenuated vaccine strains through gene modification

    • In developing serotype-specific protective immunity

  • Drug Discovery Applications:

    • Target for antimicrobial development

    • Screening platform for inhibitor discovery

    • Structure-based drug design

    • Biomarker for diagnostic development

The essential nature of cobalamin for bacterial metabolism makes cobS an attractive drug target. High-throughput screening assays using recombinant cobS can identify small-molecule inhibitors that could be developed into novel antimicrobials with activity against multiple Shigella species and potentially other enterobacteria.

  • Research Tool Applications:

    • Studying bacterial metabolism during infection

    • Investigating host-pathogen interactions

    • Developing biosensors for cobalamin detection

    • Biotechnological production of vitamin B12 derivatives

Several research groups are exploring the potential of metabolic enzymes as vaccine candidates, particularly for pathogens where traditional approaches have shown limited efficacy. The advantage of targeting conserved metabolic enzymes is the potential for cross-protection against multiple serotypes, which is particularly relevant for Shigella with its diverse serotype distribution .

What are the common challenges in expressing and purifying active Recombinant S. boydii serotype 18 Cobalamin synthase, and how can they be addressed?

Researchers frequently encounter several challenges when working with Recombinant S. boydii serotype 18 Cobalamin synthase:

  • Low Expression Levels:

    • Challenge: Poor protein yield from standard expression systems

    • Solutions:

      • Optimize codon usage for expression host

      • Test multiple fusion tags (His, GST, MBP)

      • Evaluate different promoter strengths

      • Screen various E. coli strains (BL21, Rosetta, Arctic Express)

  • Protein Insolubility:

    • Challenge: Formation of inclusion bodies

    • Solutions:

      • Lower induction temperature (16-20°C)

      • Reduce inducer concentration (0.1-0.3 mM IPTG)

      • Co-express with molecular chaperones (GroEL/ES, DnaK)

      • Add solubility-enhancing additives to growth media (5% glycerol, 1% glucose)

  • Protein Instability:

    • Challenge: Rapid degradation during purification

    • Solutions:

      • Include protease inhibitor cocktail in all buffers

      • Work at 4°C throughout purification

      • Add stabilizing agents (5-10% glycerol, 100-200 mM trehalose)

      • Reduce time between purification steps

  • Loss of Activity:

    • Challenge: Purified protein shows low enzymatic activity

    • Solutions:

      • Maintain reducing environment (1-5 mM DTT or β-mercaptoethanol)

      • Add metal cofactors during purification (0.1-0.5 mM CoCl₂)

      • Supplement with stabilizing ligands

      • Avoid exposure to air/oxygen during purification

The table below summarizes optimization strategies that have successfully addressed these challenges with similar metalloenzymes:

ChallengePrimary StrategySecondary StrategySuccess Indicator
Low yieldCodon optimizationMBP fusion tag2-5 fold increase
Insolubility18°C expressionChaperone co-expression>60% soluble fraction
InstabilityProtease inhibitorsRapid purification<10% degradation
Activity lossContinuous DTT presenceAnaerobic handling>80% activity retention

By systematically addressing these challenges, researchers can achieve yields of 3-5 mg of active protein per liter of culture with >85% purity, similar to what has been observed with other recombinant proteins from S. boydii .

How can researchers resolve discrepancies in experimental results when studying Recombinant S. boydii serotype 18 Cobalamin synthase?

When faced with experimental discrepancies in studies involving Recombinant S. boydii serotype 18 Cobalamin synthase, a systematic troubleshooting approach is essential:

  • Identify the Nature of Discrepancy:

    • Quantify the magnitude and pattern of result variation

    • Determine if discrepancies are random or systematic

    • Assess whether variation exceeds expected experimental error

  • Systematic Evaluation of Experimental Variables:

    • Protein-related factors:

      • Verify protein integrity by SDS-PAGE and western blotting

      • Confirm sequence and absence of mutations by mass spectrometry

      • Assess aggregation state by size-exclusion chromatography or DLS

    • Environmental factors:

      • Check buffer composition (pH, salt concentration)

      • Verify temperature control during assays

      • Evaluate reagent quality and freshness

    • Methodological factors:

      • Review assay protocols for procedural differences

      • Calibrate instruments and validate detection methods

      • Cross-validate results using orthogonal techniques

  • Root Cause Analysis:

    • Design controlled experiments to isolate variables

    • Implement statistical analysis to identify significant factors

    • Document all procedural details to identify hidden variables

  • Resolution Strategies:

    • Standardize protocols across laboratories

    • Establish reference standards for calibration

    • Implement quality control checkpoints

    • Consider round-robin testing between research groups

A particularly common source of discrepancy when working with cobS enzymes is the variable metal content of purified protein preparations. Inductively coupled plasma mass spectrometry (ICP-MS) analysis can determine the metal content, allowing normalization of activity data based on metal incorporation. Additionally, circular dichroism (CD) spectroscopy can verify consistent secondary structure across preparations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.