Recombinant Shigella boydii serotype 18 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Functional Role

RnfE is a subunit of the Rnf complex, which functions as an ion-translocating oxidoreductase. Its primary roles include:

  • Electron Transport: Facilitates the transfer of electrons from reduced ferredoxin (or equivalent carriers) to quinones, contributing to proton gradient formation .

  • Energy Metabolism: Supports ATP synthesis by coupling redox reactions to ion translocation across the membrane .

  • Pathogenicity: While not directly linked to virulence, the Rnf complex may influence bacterial survival under stress conditions .

The Rnf complex in Shigella is distinct from the NADH-dehydrogenase (Complex I) but shares functional homology with other bacterial Rnf systems .

Production and Purification

RnfE is produced via recombinant expression in E. coli, followed by purification using affinity chromatography (e.g., Ni-NTA for His-tagged proteins) .

Key Steps

  1. Expression: Induced with IPTG in E. coli strains optimized for high-yield protein production .

  2. Purification:

    • Buffer: Tris/PBS-based buffer with 6% Trehalose to stabilize the protein .

    • Reconstitution: Lyophilized powder is dissolved in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; rnfE; SbBS512_E1821; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRTEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is the RnfE protein structurally characterized in S. boydii serotype 18?

While the specific structural characterization of RnfE in S. boydii serotype 18 has not been comprehensively documented, research on related Rnf complexes provides valuable insights. RnfE is likely part of a six-subunit complex that includes RnfA, RnfB, RnfC, RnfD, and RnfG. Within this complex, specific subunits like RnfG and RnfD have been found to contain FMN, suggesting a role in electron transfer pathways . The protein likely contains transmembrane domains that anchor it within the cell membrane, facilitating its role in the electron transport chain. The genetic context of S. boydii serotype 18 suggests that RnfE would be encoded within its O-antigen gene cluster, which contains nine open reading frames located between galF and gnd on the chromosome .

What is the relationship between S. boydii serotype 18 O-antigen structure and Rnf complex function?

S. boydii serotype 18 possesses a distinctive O-antigen with a linear pentasaccharide repeating unit consisting of three L-rhamnose residues, one D-galacturonic acid residue, and one N-acetylgalactosamine residue arranged in a specific sequence . While the O-antigen primarily functions in pathogenicity and immune evasion, the genomic organization suggests possible co-regulation between O-antigen synthesis genes and those encoding the Rnf complex components. The relationship between these systems may involve coordinated expression during host infection, potentially linking surface structure presentation with energy metabolism adaptations. The O-antigen gene cluster organization, moving from galF to gnd, includes genes for sugar synthesis and transfer that may indirectly influence membrane structure where the Rnf complex is embedded .

How is the rnfE gene organized within the S. boydii serotype 18 genome?

The rnfE gene in S. boydii serotype 18 is likely part of the rnfABCDGE operon, consistent with the organization observed in other bacterial species. While specific information on S. boydii serotype 18 is limited, comparative genomics suggests that the rnf gene cluster would be chromosomally encoded. The serotype 18 O-antigen gene cluster contains nine ORFs between galF and gnd, all with the same transcriptional direction . Genomic analysis has shown that the presence of all Rnf components is essential for complex stability and function, with mutations in one subunit often affecting the stability of others . The genomic context may provide insights into co-regulation with other metabolic or virulence factors.

What are the most effective systems for recombinant expression of S. boydii serotype 18 RnfE protein?

For successful recombinant expression of S. boydii serotype 18 RnfE protein, several methodological considerations are critical. E. coli BL21(DE3) remains the preferred expression system due to its reduced protease activity and compatibility with T7 promoter-based vectors. Codon optimization is essential, as S. boydii may contain rare codons that limit expression efficiency in heterologous systems. For membrane protein expression, specialized vectors containing fusion tags (His6, MBP, or SUMO) can enhance solubility and facilitate purification. Expression conditions should be optimized with lower temperatures (16-20°C) and reduced inducer concentrations to prevent inclusion body formation. For functional studies, co-expression of all six Rnf subunits may be necessary, as evidence from related systems indicates that depletion of one subunit causes destabilization of the entire complex .

What genetic manipulation approaches have proven successful for studying rnfE function?

Several genetic manipulation strategies have demonstrated effectiveness for studying rnfE function. Gene replacement techniques using chloramphenicol acetyltransferase (CAT) genes through RED recombination systems have been successfully applied to similar genes in S. boydii . This approach allows for the selective inactivation of target genes while maintaining chromosomal context. For complementation studies, plasmid-based expression systems under native or inducible promoters can restore function in knockout strains. Site-directed mutagenesis of conserved residues has proven valuable in identifying functional domains. Additionally, reporter gene fusions (such as lacZ or gfp) enable monitoring of expression patterns under various conditions. The construction of random DNase I shotgun banks, as demonstrated with other S. boydii genes, provides a systematic approach to isolating and characterizing the rnfE gene and its regulatory elements .

What experimental approaches best elucidate the Na⁺-translocating function of RnfE in S. boydii serotype 18?

The Na⁺-translocating function of RnfE can be most effectively investigated through a combination of biochemical and biophysical techniques. Inverted membrane vesicle preparations allow for direct measurement of Na⁺ transport activity using radioisotope (22Na⁺) uptake assays, as demonstrated with related Rnf complexes . The specificity of this transport mechanism can be validated using ionophores such as ETH2120, which should prevent Na⁺ accumulation without affecting electron transport activity. Electrophysiological approaches, including patch-clamp techniques on reconstituted proteoliposomes, provide quantitative data on Na⁺ translocation rates and membrane potential generation. Site-directed mutagenesis of conserved residues in RnfE, followed by functional assays, can identify amino acids critical for ion transport. Additionally, fluorescent probes sensitive to Na⁺ concentrations or membrane potential (e.g., SBFI or DiSC3(5)) offer real-time monitoring of transport activity in intact cells or vesicles.

How does RnfE contribute to the electron transport chain in S. boydii serotype 18?

RnfE's contribution to the electron transport chain involves several coordinated functions within the Rnf complex. As an integral membrane component, RnfE likely participates in forming the transmembrane channel necessary for Na⁺ translocation coupled to electron transport. The protein contains conserved transmembrane domains that anchor it within the membrane bilayer, positioning functional groups for optimal interaction with other complex components. RnfE appears to work in concert with flavin-containing subunits (like RnfG and RnfD) that have been identified in related systems . These flavin prosthetic groups facilitate electron transfer from reduced ferredoxin to NAD⁺. The stoichiometry of Na⁺ transport to electron transfer (Na⁺/e⁻ ratio) determines the bioenergetic efficiency of the process, generating an electrochemical gradient that can drive ATP synthesis or other energy-requiring processes.

What is the precise mechanism of Na⁺ translocation by the Rnf complex containing RnfE?

The precise mechanism of Na⁺ translocation by the Rnf complex involves conformational changes triggered by electron transfer events. The redox-driven transport mechanism begins with ferredoxin binding to the complex, likely at RnfC, followed by electron transfer through a series of redox centers including flavin moieties identified in RnfG and RnfD subunits . These electron transfers induce conformational changes that alter Na⁺ binding sites within the transmembrane domains, sequentially changing their affinity and accessibility. This creates a pathway for Na⁺ ions to move from the cytoplasmic side to the periplasmic space against the concentration gradient. Experimental evidence from membrane vesicle studies demonstrates that this transport is electrogenic and specifically inhibited by Na⁺ ionophores but not by protonophores, confirming the Na⁺-specific nature of the translocation mechanism . The complex's similarity to the Na⁺-translocating NADH:ubiquinone oxidoreductase (Nqr) suggests conserved functional principles between these ion-translocating machines.

What evolutionary relationships exist between Rnf complexes and other ion-translocating complexes?

The Rnf complex shares significant evolutionary relationships with other ion-translocating complexes, particularly the Na⁺-translocating NADH:ubiquinone oxidoreductase (Nqr) . Both systems couple electron transfer to electrogenic Na⁺ translocation, suggesting common ancestry or convergent evolution. Protein sequence analysis reveals shared domains and functional motifs between RnfD/E and NqrB/D subunits, supporting homology between these systems. The presence of covalently bound flavin in both complexes (FMN in Rnf and FAD in Nqr) further indicates mechanistic similarities in electron transfer pathways . Phylogenetic analysis suggests that Rnf complexes represent an ancient bioenergetic system that predates oxygen respiration, potentially originating in early anaerobic environments. The wide distribution of Rnf across diverse bacterial phyla, including both anaerobes and facultative aerobes, reflects its fundamental importance in bacterial bioenergetics and adaptability.

What structural and functional insights can be gained from studying RnfE in different bacterial species?

Cross-species examination of RnfE provides valuable insights into structure-function relationships. Studies in R. capsulatus have demonstrated that the stability of individual Rnf subunits depends on the presence of other complex components, suggesting cooperative assembly . In C. tetanomorphum, RnfE has been co-purified with other complex subunits and shown to participate in NADH-dependent ferricyanide reduction . Comparative genomics reveals conserved gene organization across species, with the rnfABCDGE operon structure preserved in most organisms. The presence of RnfE in diverse bacterial species, from strict anaerobes to facultative aerobes, indicates functional versatility in different metabolic contexts. This evolutionary conservation underscores the fundamental importance of RnfE in bacterial bioenergetics and suggests potential for identifying conserved functional domains that could serve as targets for antimicrobial development.

What are the optimal conditions for purifying functional RnfE protein from recombinant systems?

Purification of functional RnfE presents significant challenges due to its membrane-integrated nature and dependence on other Rnf complex components. Successful purification requires a strategic approach beginning with gentle solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration. An effective protocol would involve expression with an affinity tag (His6 or Strep-tag II) followed by metal affinity chromatography under conditions that preserve native protein-protein interactions. For functional studies, co-expression and co-purification of all six Rnf subunits is advisable, as research has shown that depletion of one subunit causes destabilization of the entire complex . Buffer composition during purification should include physiologically relevant concentrations of Na⁺ (100-150 mM) to maintain functional conformation. Size exclusion chromatography as a final purification step helps isolate intact complexes and remove aggregates. Throughout the process, maintaining reduced conditions with agents like dithiothreitol protects redox-sensitive components.

What analytical techniques are most suitable for studying RnfE interactions with other Rnf complex components?

Several analytical techniques have proven effective for characterizing protein-protein interactions within the Rnf complex. Co-immunoprecipitation using antibodies against specific Rnf subunits has successfully demonstrated physical interactions between components, as shown in studies with RnfC and RnfB . Crosslinking approaches using bifunctional reagents followed by mass spectrometry analysis can identify specific interaction interfaces. Blue native PAGE provides a means to analyze intact membrane protein complexes while preserving native interactions. For dynamic interaction studies, fluorescence resonance energy transfer (FRET) between tagged subunits offers real-time monitoring of association in membrane environments. Surface plasmon resonance (SPR) with immobilized subunits allows quantitative determination of binding affinities and kinetics. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map interaction surfaces by identifying regions protected from solvent exchange upon complex formation.

What are the challenges in measuring electron transport activity of recombinant RnfE, and how can they be overcome?

Measuring electron transport activity of recombinant RnfE presents several methodological challenges that require specialized approaches. The membrane-bound nature of the complex necessitates appropriate reconstitution systems that maintain native-like lipid environments. Liposome reconstitution with defined lipid composition allows controlled measurement of vectorial electron transport coupled to Na⁺ translocation. Activity assays should include physiologically relevant electron donors (reduced ferredoxin) and acceptors (NAD⁺), with spectrophotometric monitoring of NAD⁺ reduction at 340 nm . Alternative electron acceptors like ferricyanide can be used for initial screening, as demonstrated in purified Rnf complexes from C. tetanomorphum . Control experiments with specific inhibitors and ionophores are essential to distinguish direct RnfE-mediated activity from background reactions. For in vivo activity measurements, 22Na⁺ transport assays in inverted membrane vesicles provide a physiological readout of coupled electron transport and ion translocation . Membrane potential-sensitive fluorescent dyes offer a non-invasive approach to monitor electrochemical gradient formation in intact systems.

How does RnfE function contribute to S. boydii serotype 18 pathogenesis?

The contribution of RnfE to S. boydii serotype 18 pathogenesis likely centers on bioenergetic adaptations during infection. As a component of the Na⁺-translocating Rnf complex, RnfE participates in generating transmembrane ion gradients that can drive ATP synthesis, particularly under the low-oxygen conditions encountered within host tissues. This energy conservation mechanism may be crucial for bacterial survival during various stages of infection. Additionally, the Rnf complex's role in redox balance maintenance could facilitate adaptation to oxidative stress encountered during host immune responses. The Na⁺ gradient established by the Rnf complex may also support secondary transport systems involved in nutrient acquisition or toxin export. Interestingly, the genetic proximity of rnf genes to the O-antigen cluster suggests potential co-regulation with virulence factors . This genomic organization may represent an adaptive linkage between metabolic capabilities and virulence expression, allowing coordinated responses to host environments.

What insights into bacterial bioenergetics can be gained from studying the Rnf complex in S. boydii serotype 18?

The study of the Rnf complex in S. boydii serotype 18 provides a valuable model for understanding alternative bioenergetic mechanisms in pathogenic bacteria. Unlike conventional respiratory chains that operate at higher redox potentials, the Rnf complex functions in the low-potential range (below -320 mV), bridging ferredoxin oxidation to NAD⁺ reduction . This represents an ancient form of energy conservation that predates aerobic respiration and continues to play critical roles in diverse bacterial metabolisms. The Na⁺-translocating capacity of the complex demonstrates how bacteria have evolved multiple strategies for converting redox energy into transmembrane ion gradients. The maintenance of this system alongside more conventional respiratory chains in facultative aerobes like S. boydii highlights the selective advantage of metabolic flexibility. Comparative analysis with Rnf complexes in other organisms may reveal how this fundamental bioenergetic system has been adapted to different ecological niches and metabolic strategies.

What are promising future research directions for understanding the role of RnfE in bacterial physiology?

Several innovative research directions promise to advance our understanding of RnfE's role in bacterial physiology. Cryogenic electron microscopy (cryo-EM) could resolve the three-dimensional structure of the complete Rnf complex, revealing the spatial arrangement of RnfE and its interactions with other subunits. Single-molecule approaches, such as single-molecule FRET or atomic force microscopy, might elucidate the conformational dynamics associated with electron transport and Na⁺ translocation. Systems biology approaches combining transcriptomics, proteomics, and metabolomics could map the regulatory networks controlling rnfE expression under different environmental conditions. Development of specific inhibitors targeting RnfE or other Rnf components would enable selective perturbation of this bioenergetic system to assess its importance in pathogenesis. Evolutionary studies tracking the acquisition and modification of rnf genes across bacterial lineages could reveal how this energy conservation system has contributed to bacterial adaptation and speciation. Synthetic biology approaches aimed at transferring or modifying the Rnf complex in heterologous hosts might yield insights into minimal requirements for function and potential biotechnological applications.

What controls and validation steps are essential when performing mutagenesis studies on rnfE in S. boydii serotype 18?

When conducting mutagenesis studies on rnfE in S. boydii serotype 18, several critical controls and validation steps must be implemented. Complementation experiments using plasmid-expressed wild-type rnfE are essential to confirm that observed phenotypes result specifically from rnfE disruption rather than polar effects or secondary mutations. Construction of precise in-frame deletions using methods like the RED recombination system helps avoid disrupting adjacent genes or regulatory elements . Phenotypic characterization should include multiple parameters beyond growth rates, such as membrane potential measurements, Na⁺ dependency, and electron transport activity. Sequencing of the entire rnf operon in mutant strains ensures that no compensatory mutations have occurred in other complex components. Western blot analysis using antibodies against multiple Rnf subunits should be performed to assess the impact of rnfE mutations on complex stability, as research has shown interdependence among subunits . For functional studies, membrane vesicle preparations from mutant and wild-type strains provide a direct comparison of Na⁺ translocation and electron transport activities in a near-native context.

How can researchers effectively model the electron transport function of the Rnf complex in vitro?

In vitro modeling of the Rnf complex's electron transport function requires carefully designed experimental systems that recapitulate the native membrane environment and provide appropriate electron donors and acceptors. Proteoliposome reconstitution with defined phospholipid composition represents an optimal approach, allowing control over protein orientation and internal/external buffer conditions. The experimental setup should include physiologically relevant electron donors (reduced ferredoxin) generated either enzymatically or using chemical reductants like titanium (III) citrate . Spectrophotometric assays monitoring NAD⁺ reduction at 340 nm provide a direct measure of electron transport activity. For studying Na⁺ translocation, proteoliposomes loaded with 22Na⁺ or fluorescent Na⁺ indicators enable quantification of transport rates. Alternative approaches include solid-supported membrane (SSM) electrophysiology, which allows measurement of charge translocation associated with electron transport events. Systematic variation of substrate concentrations, pH, temperature, and ion composition helps establish the kinetic and thermodynamic parameters governing complex function.

What methodological approaches can resolve contradictory data regarding RnfE function across different experimental systems?

Resolving contradictory data regarding RnfE function requires systematic methodological approaches that account for experimental variables and system-specific differences. Direct comparison studies using identical genetic backgrounds, expression systems, and assay conditions can identify whether discrepancies arise from methodological differences or biological variability. Complementation experiments introducing RnfE variants from different species into a common genetic background allow evaluation of protein-specific functional differences while controlling for genomic context. Chimeric proteins combining domains from different RnfE homologs can pinpoint regions responsible for functional variations. Application of multiple independent techniques to measure the same functional parameter (e.g., Na⁺ transport, electron transfer rates) provides technical cross-validation. Time-resolved studies may reveal differences in kinetic parameters rather than absolute functional capacity. Structural analysis comparing RnfE proteins from different systems can identify variations in critical functional domains. Computational modeling incorporating experimental data from multiple systems might reconcile apparently contradictory observations by identifying conditional parameters that determine functional outcomes.

What are the major unresolved questions regarding RnfE structure and function in S. boydii serotype 18?

Several fundamental questions regarding RnfE in S. boydii serotype 18 remain unresolved. The high-resolution structure of RnfE, alone or within the complete Rnf complex, has not been determined, limiting our understanding of the molecular basis for Na⁺ translocation and electron transport. The precise stoichiometry of Na⁺ ions translocated per electron transferred remains unclear, which is critical for understanding the bioenergetic efficiency of the system. The specific contribution of RnfE to complex assembly, stability, and function has not been fully characterized, particularly regarding which domains are involved in protein-protein interactions versus ion translocation. The regulatory mechanisms controlling rnfE expression in response to environmental conditions such as oxygen levels, redox state, and nutrient availability need further investigation. The potential coordination between the Rnf complex and other bioenergetic systems during different growth phases or infection stages represents another knowledge gap. Additionally, the evolutionary relationship between the RnfE of S. boydii serotype 18 and homologs in other species requires more detailed phylogenetic analysis to understand functional adaptations.

What technical limitations currently hinder comprehensive characterization of recombinant RnfE?

Comprehensive characterization of recombinant RnfE faces several technical limitations. The membrane-integrated nature of RnfE presents significant challenges for expression, purification, and structural studies, as traditional approaches often result in misfolding, aggregation, or loss of function. Current membrane protein crystallization techniques have limited success with multi-subunit complexes like Rnf, restricting high-resolution structural determination. Reconstitution of functional Rnf complexes in artificial membrane systems remains challenging due to the requirement for coordinated assembly of six different subunits in the correct stoichiometry and orientation. The redox-sensitive nature of the complex necessitates strict anaerobic conditions during purification and assays, requiring specialized equipment and expertise. Specific antibodies against S. boydii RnfE are not widely available, limiting immunological detection and localization studies. Development of specific inhibitors targeting RnfE function would provide valuable tools for dissecting its role but remains an unmet need. The complexity of the electron transport process, involving multiple cofactors and protein-protein interactions, complicates kinetic and mechanistic studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.